SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025480 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025480
Domain Number 1 Region: 535-564,663-742
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000903
Family Anti-sigma factor antagonist SpoIIaa 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025480   Gene: ENSGGOG00000028058   Transcript: ENSGGOT00000034740
Sequence length 759
Comment pep:known_by_projection chromosome:gorGor3.1:3:49871085:49880830:-1 gene:ENSGGOG00000028058 transcript:ENSGGOT00000034740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLADASGPRDTQALLSATQAMELRRRDYHMERPLLNQEHLEELGRWGSAPRTRQWQTWL
QCSRARAYALLLQHLPVLVWLPRYPVRDWLLGDLLSGLSVAIMQLPQGLAYALLAGLPPV
FGLYSSFYPVFIYFLFGTSRHISVGTFAVMSVMVGSVTESLAPQALNDSMINETARDAAR
VQVASTLSVLVGLFQVGLGLIHFGFVVTYLSEPLVRGYTTAAAVQVFVSQLKYVFGLHLS
SHSGPLSLIYTVLEVCWKLPQSKVGTVVTAAVAGVVLVVVKLLNDKLQQQLPMPIPGELL
TLIGATGISYGMGLKHRFEVDVVGNIPAGLVPPVAPNTQLFSKLVGSAFTIAVVGFAIAI
SLGKIFALRHAYRVDSNQELVALGLSNLIGGIFQCFPVSCSMSRSLVQESTGGNSQVAGA
ISSLFILLIIVKLGELFHDLPKAVLAAIIIVNLKGMLRQLSDMRSLWKANRADLLIWLVT
FTATILLNLDLGLVVAVIFSLLLVVVRTQMPHYSVLGQVPDTDIYRDVAEYSEAKEVPGV
KVFRSSATVYFANAEFYSDALKQRCGVDVDFLISQKKKLLKKQEQLKLKQLQKEEKLQKQ
AASSKGTSVSINVNTSLEDMRSNNVEDCKMMQVSSGDKMEDATASGQEDSKAPDGSTLKA
LGLPQPDFHSLILDLGALSFVDTVCLKSLKNIFHDFREIEVEVYMAACHSPVVSQLEAGH
FFDASITKKHLFASVHDAVTFALQHPRPVPDSPVSDTRL
Download sequence
Identical sequences G3SBK4
XP_004034150.1.27298 ENSGGOP00000025480 ENSGGOP00000025480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]