SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025488 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025488
Domain Number 1 Region: 425-504
Classification Level Classification E-value
Superfamily HMG-box 9.43e-27
Family HMG-box 0.000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025488   Gene: ENSGGOG00000012765   Transcript: ENSGGOT00000033906
Sequence length 633
Comment pep:known_by_projection chromosome:gorGor3.1:1:184128867:184144141:1 gene:ENSGGOG00000012765 transcript:ENSGGOT00000033906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLSLAVALQLWMSMRSPISAQLALDGVGTMVNCTIKSEEKKEPCHEAPQGSATAAEPQPG
DPARASQDSADPQAPAQGNFRGSWDCSSPEGNGSPEPKRPGASEAASGSQEKLDFNRNLK
EVVPAIEKLLSSDWKERFLGRNSMEAKDVKGTQESLAEKELQLLVMIHQLSTLRDQLLTA
HSEQKNMAAMLFEKQQQQMELARQQQEQVGPVQWVWLSFQEKTHTGFLCLQQVNMPYVMI
PAFPPSHQPLPVTPDSQLALPIQPIPCKPVEYPLQLLHSPPAPVVKRPGAMAAHHPLQEP
SQPLNLTAKPKAPELPNTSSSPSLKMSSCAPRPPSHGGPTRDLQSSPPSLPLGFLGEGDA
VTKAIQDARQLLHSHSGALDGSPNTPFRKDLISLDSSPAKERLEDGCVHPLEEAMLSCDM
DGSRHFPESRNSSHIKRPMNAFMVWAKDERRKILQAFPDMHNSSISKILGSRWKSMTNQE
KQPYYEEQARLSRQHLEKYPDYKYKPRPKRTCIVEGKRLRVGEYKALMRTRRQDARQSYV
IPPQAGQVQMSSSDVLYPRAAGMPLAQPLVEHYVPRSLDPNMPVIVNTCSLREEGEGTDD
RHSVADGEMYRYSEDEDSEGEEKSDGELVVLTD
Download sequence
Identical sequences ENSGGOP00000012453 ENSGGOP00000025488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]