SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025507 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025507
Domain Number 1 Region: 108-211
Classification Level Classification E-value
Superfamily EF-hand 4.08e-27
Family Eps15 homology domain (EH domain) 0.00000479
Further Details:      
 
Domain Number 2 Region: 214-306
Classification Level Classification E-value
Superfamily EF-hand 6.65e-27
Family Eps15 homology domain (EH domain) 0.00000547
Further Details:      
 
Domain Number 3 Region: 10-82
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000011
Family Eps15 homology domain (EH domain) 0.00013
Further Details:      
 
Domain Number 4 Region: 331-444
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000628
Family Myosin rod fragments 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000025507
Domain Number - Region: 437-489
Classification Level Classification E-value
Superfamily XseB-like 0.0157
Family XseB-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025507   Gene: ENSGGOG00000006160   Transcript: ENSGGOT00000032423
Sequence length 887
Comment pep:known_by_projection chromosome:gorGor3.1:1:53016014:53142990:-1 gene:ENSGGOG00000006160 transcript:ENSGGOT00000032423 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLICLFQLSSGNPVYEKYYRQVDTGNTGRVLASDAAAFLKKSGLPDLILGKIWDLADTDG
KGILNKQQIFKCCTVIFCSFSGIAVINQKVNLGICCLRAHDTSSPLLISGTSAAELPWAV
KPEDKAKYDAIFDSLSPVNGFLSGDKVKPVLLNSKLPVDILGRVWELSDIDHDGMLDRDE
FAVAMFLVYCALEKEPVPMSLPPALVPPSKRKTWVVSPAEKAKYDEIFLKTDKDMDGFVS
GLEVREIFLKTGLPSTLLAHIWSLCDTKDCGKLSKDQFALAFHLISQKLIKGIDPPHVLT
PEMIPPSDRASLQKNVVGSSPVADFSAIKELDTLNNEIVELQREKNNVEQDLKEKEDTIK
QRASEVQDLQDEVQRENTNLQKLQAQKQQVQELLDELDEQKAQLEEQLKEVRKKCAEEAQ
LISSLKAELTSQESQISTYEEELAKAREELSRLQQETAELEESVESGKAQLEPLQQHLQD
SQQEISSMQMKLMEMKDLENHNSQLNWCSSPHSILVNGATDYCSLSTSSSETANLNEHVE
GQSNLESEPIHQESPGRSSPELLPSGMTDENEVTTAVTEKVCSELDNNRHSKEVKNYSLS
SGVTTVNIVNLDFFVTGDPFKDDPFGKIDPFGGDPFKGSDPFASDCFFRQSTDPFATSST
DPFSAANNSSITSVETLKHNDPFAPGGTVVAASDSATDPFASVFGNESFGGGFADFSTLS
KTKVNNEDPFRSATSSSVSNVVITKNVFEETLVKSEDEPPALPPKIGTPTRPCPPPPGKR
SINKLDSPDPFKLNDPFQPFPGNDSPKEKDPEMFCDPFTSATTTTNKEADPSNFANFSAY
PSEEDMIEWAKRESEREEEQRLARLNQQEQEDLELAIALSKSEISEA
Download sequence
Identical sequences ENSGGOP00000006035 ENSGGOP00000025507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]