SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025522 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025522
Domain Number 1 Region: 403-594
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.79e-49
Family cAMP-binding domain 0.0001
Further Details:      
 
Domain Number 2 Region: 156-401
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.15e-39
Family Voltage-gated potassium channels 0.0057
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000025522
Domain Number - Region: 615-661
Classification Level Classification E-value
Superfamily Tropomyosin 0.0915
Family Tropomyosin 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025522   Gene: ENSGGOG00000013840   Transcript: ENSGGOT00000024514
Sequence length 687
Comment pep:known_by_projection chromosome:gorGor3.1:4:48383353:48427596:-1 gene:ENSGGOG00000013840 transcript:ENSGGOT00000024514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNNIINTRQSFVTMPNVIVPDIEKEIRRMENGACSSFSEDDDSASISEESENENPHARG
SFSYKSLRKGGPSQREQYLPGAIALFNVNNSSNKDQKPRHVHYKQKTNKYKSDDKNENKN
DPSRKKLYSKEPCHRSETRALKKKKIWEKKEVVVIDPSGNTYYNWLFCITLPVMYNWTMV
IARACFDELQSDYLEYWLILDYVSDIVYLIDMFVRTRTGYLEQGLLVKEELKLINKYKSN
LQFKLDVLSLIPTDLLYFKLGWNYPEIRLNRLLRFSRMFEFFQRTETRTNYPNIFRISNL
VMYIVIIIHWNACVFYSISKAIGFGNDTWVYPDINDPEFGRLARKYVYSLYWSTLTLTTI
GETPPPVRDSEYVFVVVDFLIGVLIFATIVGNIGSMISNMNAARAEFQARIDAIKQYMHF
RNVSKDMEKRVIKWFDYLWTNKKTVDEKEVLKYLPDKLRAEIAINVHLDTLKKVRIFADC
EAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSY
FGEISILNIKGSKAGNRRTANIKSIGYSDLFCLSKDDLMEALTEYPDAKTMLEEKGKQIL
MKDGLLDLNIANAGSDPKDLEEKVTRMEGSVDLLQTRFARILAEYESMQQKLKQRLTKVE
KFLKPLIDTEFSSIEGPGAESGPIDST
Download sequence
Identical sequences ENSGGOP00000025522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]