SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025525 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025525
Domain Number 1 Region: 6-98
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000916
Family G proteins 0.0000589
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025525   Gene: ENSGGOG00000024847   Transcript: ENSGGOT00000031185
Sequence length 100
Comment pep:novel chromosome:gorGor3.1:unplaced:55129489:55130136:1 gene:ENSGGOG00000024847 transcript:ENSGGOT00000031185 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAQGKPRVQFKLVLVSDVGAGKTTPMKHHLAGESEKYRATFGVMVYLLVFHTNRGPLNL
ININGQEKLGGLRDGYDLQSQCAIIMFDVTSRVTYKNVPN
Download sequence
Identical sequences ENSGGOP00000025525 ENSGGOP00000025525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]