SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025571 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025571
Domain Number 1 Region: 22-148
Classification Level Classification E-value
Superfamily Lysozyme-like 3.22e-46
Family C-type lysozyme 0.0000183
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025571   Gene: ENSGGOG00000026765   Transcript: ENSGGOT00000024153
Sequence length 159
Comment pep:novel chromosome:gorGor3.1:X:48929331:48931344:1 gene:ENSGGOG00000026765 transcript:ENSGGOT00000024153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAWGTVVVTLATLMVVTVDAKIYERCELAARLERAGLNGYKGYGVGDWLCMAHYESGFD
TAFVDHNPDGSSEYGIFQLNSAWWCDNGITPTKNLCHMDCHDLLNRHILDDIRCAKQIVS
SQNGLSAWTSWRLHCSGHDLSEWLKGCDMHVKIDPKIHP
Download sequence
Identical sequences A0A140VJN7 G3SBU4 H2QYJ5 Q96QH8
ENSGGOP00000025571 ENSPTRP00000037522 gi|118498373|ref|NP_995328.2| gi|120952755|ref|NP_001073369.1| 9598.ENSPTRP00000037522 9606.ENSP00000304762 9606.ENSP00000305847 ENSP00000304762 ENSP00000305847 ENSP00000304762 ENSP00000305847 ENSP00000366139 ENSP00000471332 ENSP00000471854 ENSP00000472148 ENSGGOP00000025571 NP_001073369.1.87134 NP_001073369.1.92137 NP_995328.2.87134 NP_995328.2.92137 XP_003812199.1.60992 XP_004064139.1.27298 XP_009437295.1.37143 XP_016885001.1.92137 ENSPTRP00000037522 ENSP00000304762 ENSP00000305847 ENSP00000366139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]