SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025626 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025626
Domain Number 1 Region: 363-468
Classification Level Classification E-value
Superfamily SRCR-like 7.46e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00017
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000025626
Domain Number - Region: 192-286
Classification Level Classification E-value
Superfamily STAT 0.000432
Family STAT 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025626   Gene: ENSGGOG00000025554   Transcript: ENSGGOT00000031312
Sequence length 469
Comment pep:known_by_projection chromosome:gorGor3.1:8:15706782:15789724:-1 gene:ENSGGOG00000025554 transcript:ENSGGOT00000031312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCYLSAIIRISLLNKKTSMEQWDHFHNQQEDTDSCSESVKFDARSMTALLPPNPKNSPSL
QEKLKSFKAALIALYLLVFAVLIPLIGIVAAQLLKWETKNCSVGSTNANDITQSLMGKGN
DSEEEMRFQEVFMEHMSNMEKRIQHISDMEANLMDTEHFQNFSMTTDQRFNDILLQLSTL
FSSVQGHGNAIDEISKSLISLNTTLLDLQLNIENLNGKIQENTFKQQEEISKLEERVYNV
SAEIMAMKEEQVHLEQEIKGEVKVLNNITNDLRLKDWEHSQTLRNITLIQGPPGPPGEKG
DRGPTGESGPRGFPGPIGPPGLKGDRGAIGFPGSRGLPGYAGRPGNSGPKGQKGEKGSGN
TLTPFTKVRLVGGSGPHEGRVEILHSGQWGTICDDRWEVRVGQVVCRSLGYPGVQAVHKA
AHFGQGTGPIWLNEVFCFGRESSIEECKFRQWGTRACSHSEDAGVTCTL
Download sequence
Identical sequences ENSGGOP00000018457 ENSGGOP00000025626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]