SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025634 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025634
Domain Number 1 Region: 54-221
Classification Level Classification E-value
Superfamily PR-1-like 2.49e-51
Family PR-1-like 0.00011
Further Details:      
 
Domain Number 2 Region: 289-387
Classification Level Classification E-value
Superfamily LCCL domain 9.55e-30
Family LCCL domain 0.0011
Further Details:      
 
Domain Number 3 Region: 391-496
Classification Level Classification E-value
Superfamily LCCL domain 9.15e-27
Family LCCL domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025634   Gene: ENSGGOG00000025673   Transcript: ENSGGOT00000024644
Sequence length 501
Comment pep:known_by_projection chromosome:gorGor3.1:8:73413411:73463422:1 gene:ENSGGOG00000025673 transcript:ENSGGOT00000024644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCTAREWLRVTTVLFMARAIPAMVVPNATLLEKLLEKYMDEDGEWWTAKQRGKRAITDN
DMQSILDLHNKLRSQVYPTASNMEYMTWDVELERSAESWAESCLWEHGPASLLPSIGQNL
GAHWGRYRPPTFHVQSWYDEVKDFSYPYEHECNPYCPFRCSGPVCTHYTQVVWATSNRIG
CAINLCHNMNIWGQIWPKAVYLVCNYSPKGNWWGHAPYKHGRPCSACPPSFGGGCRENLC
YKEGSDRYYPPREEETNEIERQQSQVHDTHVRTRSDDSSRNEVISTQQMSQIVSCEVRLR
DQCKGTTCNRYECPAGCLDSKAKVIGSVHYEMQSSICRAAIHYGIIDNDGGWVDITRQGR
KHYFIKSNRNGIQTIGKYQSANSFTVSKVTVQAVTCETTVEQLCPFHKPASHCPSRVYCP
RNCMQANPHYARVIGTRVYSDLSSICRAAVHAGVVRNHGGYVDVMPVDKRKTYIASFQNG
IFSESLQNPPGGKAFRVFAVV
Download sequence
Identical sequences ENSGGOP00000025634 ENSGGOP00000025634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]