SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025635 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025635
Domain Number 1 Region: 264-581
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.5e-59
Family Choline kinase 0.082
Further Details:      
 
Domain Number 2 Region: 657-917
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 1.07e-58
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.0008
Further Details:      
 
Domain Number 3 Region: 903-1057
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 3.06e-42
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.00022
Further Details:      
 
Domain Number 4 Region: 42-241
Classification Level Classification E-value
Superfamily HAD-like 1.09e-32
Family YihX-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025635   Gene: ENSGGOG00000007098   Transcript: ENSGGOT00000029419
Sequence length 1059
Comment pep:known_by_projection chromosome:gorGor3.1:12:111238796:111316235:1 gene:ENSGGOG00000007098 transcript:ENSGGOT00000029419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCVRSCFQSPRLQWVWRTAFLKHTQRRHQGSHRWTHLGGSTYRAVIFDMGGVLIPSPGRV
AAEWEVQNRIPSGTILKALMEGGENGPWMRFMRAEITAEGFLREFGRLCSEMLKTSVPVD
SFFSLLTSERVAKQFPVMTEAITQIRAKGLQTAVLSNNFYLPNQKSFLPLDRKQFDVIVE
SCMEGICKPDPRIYKLCLERLGLQPSESIFLDDLGPNLKEAARLGIHTIKVNDPETAVKE
LEALLGFTLRVGVPSTRPVKKTMEIPKDSLQKYLKDLLGIQTTGPLELLQFDHGQSNPTY
YIRLANRDLVLRKKPPGTLLPSAHAIEREFRIMKALANAGVPVPNVLDLCEDSSVIGTPF
YVMEYCPGLIYKDPSLPGLEPSHRRAIYTAMNTVLCKIHSVDLQAVGLEDYGKQGDYIPR
QVRTWVKQYRASETSTIPAMERLIEWLPLHLPRQQRTTVVHGDFRLDNLVFHPEEPEVLA
VLDWELSTLGDPLADVAYSCLAHYLPSSFPVLRGINDCDLTQLGIPAAEEYFRMYCLQMG
LPPTENWNFYMAFSFFRVAAILQGVYKRSLTGQASSTYAEQTGKLTEFVSNLAWDFAVKE
GFRVFKEMAFTNPLTRSYHMWARPQSQWCPTGSRSYSSVPEASPAHTSRGGLVISPESLS
PPVRELYHRLKHFMEQRVYPAEPELQSHQASAARWSPSPLIEDLKEKAKAEGLWNLFLPL
EADPEKKYGAGLTNVEYAHLCELMGTSLYAPEVCNCSAPDTGNMELLVRYGTEVQKARWL
IPLLEGKARSCFAMTEPQVASSDATNIEASIREEDSFYVINGHKWWITGILDPRCQLCVF
MGKTDPHAPRHRQQSVLLVPMDTPGIKIIRPLTVYGLEDAPGGHGEVRFEHVRVPKENMV
LGPGRGFEIAQGRLGPGRIHHCMRLIGFSERALALMKARVKSRVAFGKPLVEQGTVLADI
AQSRVEIEQARLLVLRAAHLMDLAGNKAAALDIAMIKMVAPSMASRVIDRAIQAFGAAGL
SSDYPLAQFFTWARALRFADGPDEVHRATVAKLELKHRI
Download sequence
Identical sequences G3SC08
XP_004053950.1.27298 ENSGGOP00000025635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]