SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025637 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025637
Domain Number 1 Region: 19-364
Classification Level Classification E-value
Superfamily L domain-like 6.46e-49
Family Ngr ectodomain-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025637   Gene: ENSGGOG00000025167   Transcript: ENSGGOT00000025607
Sequence length 383
Comment pep:novel chromosome:gorGor3.1:X:151428595:151433887:1 gene:ENSGGOG00000025167 transcript:ENSGGOT00000025607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSLPASCLLAQAVIACGNVKTKHVPALTDPGLTTLYLAENEIAKIPAHTFLGLPNLEWL
DLSKNKLDPRGLHPHAFKDLMRLKRLNLDGNSLTTVPALPASLQELKLNDNLLQGLQRSS
FRGLSQLLTLEVEGNQLRDRDIPLAFQPLCSLLYLRLDRNRLRAIPRGLPCSLQELHLGT
NLIEEVAEGALSHIHSLSLLVLSHNWLQEHRLAPRAWIHLPKLETLDLSYNRLVHVPSFL
PRGLRRLTLHHNHIERIPGYAFAHMKPGLEFLHLSHNRLQADSIHSMSFLGLRASLAELL
LDHNQLQAIPRGLLGLKGLQVLGLSHNRIRQVPLNSICDTRMAQDSNLISTHLENNLIDR
RRIPPTAFSCIRAYHSVVLQPQR
Download sequence
Identical sequences ENSGGOP00000025637 ENSGGOP00000025637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]