SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025651 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025651
Domain Number 1 Region: 4-138
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 4.16e-45
Family Cofilin-like 0.000000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025651   Gene: ENSGGOG00000025228   Transcript: ENSGGOT00000026065
Sequence length 153
Comment pep:known_by_projection chromosome:gorGor3.1:14:35274585:35285573:-1 gene:ENSGGOG00000025228 transcript:ENSGGOT00000026065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDE
LPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKV
FEIRNTEDLTEEWLREKLFSTNVNFCVSKVFMY
Download sequence
Identical sequences ENSGGOP00000025651 ENSGGOP00000025651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]