SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025736 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025736
Domain Number 1 Region: 281-392
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.11e-22
Family SPRY domain 0.013
Further Details:      
 
Domain Number 2 Region: 425-575
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000503
Family Nucleotide and nucleoside kinases 0.029
Further Details:      
 
Domain Number 3 Region: 2-40
Classification Level Classification E-value
Superfamily SAP domain 0.00000000421
Family SAP domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025736   Gene: ENSGGOG00000009804   Transcript: ENSGGOT00000022918
Sequence length 839
Comment pep:known_by_projection chromosome:gorGor3.1:19:38638311:38684204:1 gene:ENSGGOG00000009804 transcript:ENSGGOT00000022918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVRRLKVNELREELQRRGLDTRGLKAELAERLQAALEAEEPDDERELDADDQPGRPGHI
NEEVETEGGSELEGTAQPPPPGLQPHAEPGGYSGPDGHYAMDNITRQNQFYDTQVIKQEN
ESGYERRPLEMEQQQAYRPEMKTEMKQGAPTSFLPPEASQLKPDRQQFQSRKRPYEENRG
RGYFEHREDRRGRSPQPPAEEDEDDFDDTLVAIDTLWGNCGLDLHQNPCRAPSKDIVSPH
EGFSFHWIERRAPHGRDGQIKFLSEINEEISVKHLPSTEPDPHVVRIGWSLDSCSTQLGE
EPFSYGYGGTGKKSTNSRFENYGDKFAENDVIGCFADFECGNDVELSFTKNGKWMGIAFR
IQKEALGGQALYPHVLVKNCAVEFNFGQRAEPYCSVLPGFTFIQHLPLSERIRGTVGPKS
KAECEILMMVGLPAAGKTTWAIKHAASNPSKKYNILGTNAIMDKMRVMGLRRQRNYAGRW
DVLIQQATQCLNRLIQIAARKKRNYILDQTNVYGSAQRRKMRPFEGFQRKAIVICPTDED
LKDRTIKRTDEEGKDVPDHAVLEMKANFTLPDVGDFLDEVLFIELQREEADKLVRQYNEE
GRKAGPPPEKRFDNRGGGGFRGRGGGGGFQRYDNRGPPGGNRGGFQNRGGGSSGGGNYRG
GFNRSGGGGYSQNRWGNNNRDNNNSNNRGSYNRAPQQPSYSPARNPPGASTYNKNSNIPG
SSANTSTPTVSSYSPPQPSYSQPPYNQGGYSQGYTAPPPPPPPPPAYNYGSYGGYNPAPY
TPPPPPTAQTYPQPSYNQYQQYAQQWNQYYQNQGQWPPYYGNYDYGSYSGNTQGGTSTQ
Download sequence
Identical sequences ENSGGOP00000025736 ENSGGOP00000009579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]