SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025759 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025759
Domain Number 1 Region: 8-84
Classification Level Classification E-value
Superfamily PDZ domain-like 1.06e-19
Family PDZ domain 0.0000769
Further Details:      
 
Domain Number 2 Region: 312-341
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000363
Family LIM domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025759   Gene: ENSGGOG00000002417   Transcript: ENSGGOT00000032947
Sequence length 352
Comment pep:known_by_projection chromosome:gorGor3.1:8:22453797:22468869:1 gene:ENSGGOG00000002417 transcript:ENSGGOT00000032947 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALTVDVAGPAPWGFRITGGRDFHTPIMVTKVAERGKAKDADLRPGDIIVAINGESAEGM
LHAEAQSKIRQSPSPLRLQLDRSQATSPGQTNGDSSLEVLATRFQGSVRTYTESQSSVRS
SYSSPTSLSPRACSPFSPPPSSSPLTGEAAISRSFQSLACSPGLPAADRLSYSGRPGSRQ
AGLGRAGDSAVLVLPPSPGPRSSRPSMDSEGGSLLLDEDSEVFKMLQENREGRAAPRQSS
SFRLLQEALEAEERGGTPAFLPSSLSPQSSLPASRALATPPKLHTCEKCSTSIANQAVRI
QEGRYRHPGCYTCADCGLNLKMRGHFWVGDELYCEKHARQRYSAPATLSSRA
Download sequence
Identical sequences ENSGGOP00000025759 XP_018887811.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]