SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025764 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025764
Domain Number 1 Region: 66-192
Classification Level Classification E-value
Superfamily Lysozyme-like 9.65e-48
Family C-type lysozyme 0.0000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025764   Gene: ENSGGOG00000022362   Transcript: ENSGGOT00000025373
Sequence length 194
Comment pep:novel chromosome:gorGor3.1:10:33903816:33924840:-1 gene:ENSGGOG00000022362 transcript:ENSGGOT00000025373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQDAHLSCLSPTKWSSVSSADSTEKSASGAGTRNRPFQFCLRQALRMKAAGILTLIGCLV
IGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQTVLDDGSIDYGI
FQINSFAWCRRGKLKENNHCHVACSALITDDLTDAILCAKKIVKETQGMNYWQGWKKHCE
GRDLSDWKKDCEVS
Download sequence
Identical sequences G3SCD7
ENSGGOP00000025764 ENSGGOP00000025764 XP_004049275.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]