SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025769 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025769
Domain Number 1 Region: 61-134
Classification Level Classification E-value
Superfamily Ribosomal protein S18 3.01e-22
Family Ribosomal protein S18 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025769   Gene: ENSGGOG00000006303   Transcript: ENSGGOT00000028187
Sequence length 197
Comment pep:known_by_projection chromosome:gorGor3.1:6:44975890:44993849:-1 gene:ENSGGOG00000006303 transcript:ENSGGOT00000028187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATLKALMSVCGRLLRGLLAGPAATSWSRLPARGFREVVVEIQEGKTTIIEGRITATPKE
SPNPPNPSGQCPICRWNLKHKYNYDDVLLLSQFIRPHGGMLPRKITGLCQEEHRKIEECV
KMAHRAGLLPNHRPRLPEGVVPKSKPQLNRYLTRWAPGSVKPIYKKGPRWNRVRMPVGSP
LLRDNVCYSRTPWKLYH
Download sequence
Identical sequences ENSGGOP00000025769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]