SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025772 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025772
Domain Number 1 Region: 622-690,923-1259
Classification Level Classification E-value
Superfamily Ras GEF 4.32e-119
Family Ras GEF 0.0000186
Further Details:      
 
Domain Number 2 Region: 224-445
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.88e-44
Family DBL homology domain (DH-domain) 0.00023
Further Details:      
 
Domain Number 3 Region: 24-156
Classification Level Classification E-value
Superfamily PH domain-like 2.44e-19
Family Pleckstrin-homology domain (PH domain) 0.0057
Further Details:      
 
Domain Number 4 Region: 434-591
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000129
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025772   Gene: ENSGGOG00000009950   Transcript: ENSGGOT00000031108
Sequence length 1262
Comment pep:known_by_projection chromosome:gorGor3.1:15:58721053:58850278:-1 gene:ENSGGOG00000009950 transcript:ENSGGOT00000031108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKGIRLNDGHVASLGLLARKDGTRKGYLSKRSSDNTKWQTKWFALLQNLLFYFESDSSS
RPSGLYLLEGCVCDRAPSPKPALSAKEPLEKQHHHYFTVNFSHENQKALELRTEDAKDCD
EWVAAIAHASYRTLATEHEALMQKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKAEI
ASLLKDNERIQSTQTVAPNDEDSDIKKIKKVQSFLRGWLCRRKWKTIIQDYIRSPHADSM
RKRNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMF
LHQIFYQGLKARISSWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDK
LLKHYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEE
LSRIMHDEVSETENIRKNLAIERMIIEGCEILLDTSQTFVRQGSLIQVPMSEKGKITRGR
LGSLSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKNGVISLIDCTLLEEPESTEEEELE
AKGSGQDIDHLDFKIGVEPKDSPPFTVILVASSRQEKAAWTSDISQCVDNIRCNGLMMNA
FEENSKVTVPQMIKSDASLYCDDVDIRFSKTMNSCKVLQIRYASVERLLERLTDLRFLSI
DFLNTFLHSYRVFTTAIVVLDKLITIYKKPISAIPARSLELLFASGQNNKLLYGEPPKSP
RATRKFSSPPPLSITKTSSPSRRRKLSLNIPIITGGKALDLAALSCNSNGYTSMYSAMSP
FSKATLDTSKLYVSSSFTNKIPDEGDTTPEKPEDPSALSKQSSEVSMREESDIDQNQSDD
GDTETSPTKSPTTPKSVKNKNSSEFPLFSYNNGVVMTSCRELDNNRSALSAASAFAIATA
GANEGTPNKEKYRRMSLASAGFPPDQRNGDKEFVIRRAATNRVLNVLRHWVSKHSQDFET
NDELKCKVIGFLEEVMHDPELLTQERKAAANIIRLTVLKSLSGLHIFSTEARVCAEGVKA
EPFENHSALEIAEQLTLLDHLVFKKIPYEEFFGQGWMKLEKNERTPYIMKTTKHFNDISN
LIASEIIRNEDINARVSAIEKWVAVADICRCLHNYNAVLEITSSMNRSAIFRLKKTWLKV
SKQTKALIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFIEEGTPNYTEDG
LVNFSKMRMISHIIREIRQFQQTAYKIEHQAKVTQYLLDQSFVMDEESLYESSLRIEPKL
PT
Download sequence
Identical sequences ENSGGOP00000009726 ENSGGOP00000025772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]