SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025808 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025808
Domain Number 1 Region: 375-558
Classification Level Classification E-value
Superfamily NTF2-like 1.75e-63
Family NTF2-like 0.000000802
Further Details:      
 
Domain Number 2 Region: 111-205
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.82e-36
Family Non-canonical RBD domain 0.0000567
Further Details:      
 
Domain Number 3 Region: 556-623
Classification Level Classification E-value
Superfamily UBA-like 1.4e-24
Family TAP-C domain-like 0.00023
Further Details:      
 
Domain Number 4 Region: 209-364
Classification Level Classification E-value
Superfamily L domain-like 2.47e-17
Family mRNA export factor tap 0.0000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025808   Gene: ENSGGOG00000016043   Transcript: ENSGGOT00000032666
Sequence length 626
Comment pep:novel chromosome:gorGor3.1:X:99592096:99611681:-1 gene:ENSGGOG00000016043 transcript:ENSGGOT00000032666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSTLKKCGTYRTEVAECHDHGSTFQGRKKGGSSFRDNFDKRNSHYEHGGYERPPSHCQE
NDGSVEMRDVHKDQQLRHTPYSIRCERRMKWHSEDEIRITTWRNRKPPERKMSQDTQDGY
TRNWFKVTIPYGIKYDKAWLVNSIQSHCSDPFTPVDFHYVRNQACFFVQDASTASALKDV
SYKICDDENQKICIFVNHSTAPYSVKHKLKPGQMEMLKLTMNKRYNVSQQALDLQNLRFD
PDLMGRDIDIILNRRNCMAATLKIIERNFPELLSLNLCNNKLYHLDGLSDIIEKAPKVKT
LNLSKNKEVGLPHLPRTSSIQMLVPWTEKSPLCATLNCQSLHSIAIRDCFPKLLRLDGQE
LSPPMIVDIDSSETMKPCKENFTGSETLKHLVLQFLKQYYSIYDSGDRQGLLGAYHNEAC
FSLAIPFDPKDSAPNSLCKYFEDSRNMKTLKDPYLKGELLRRTKRDIVDSLSALPKTQHD
LSSILVDVWCQTERMLCFSVNGVFKEVEGQSQGSVLAFTRTFIATPGSSSSLCIVNDELF
VRNASPQETQSAFSIPVSTLSSSSEPSLSQEQQEMVQAFSAQSGMKLEWSQKCLQDNEWN
YTRAGQAFTMLQTEGKIPAEAFTQIS
Download sequence
Identical sequences ENSGGOP00000025808 ENSGGOP00000015656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]