SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025810 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025810
Domain Number 1 Region: 210-301
Classification Level Classification E-value
Superfamily HMG-box 4.84e-25
Family HMG-box 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025810   Gene: ENSGGOG00000025016   Transcript: ENSGGOT00000034496
Sequence length 601
Comment pep:novel chromosome:gorGor3.1:4:121894949:121896814:1 gene:ENSGGOG00000025016 transcript:ENSGGOT00000034496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESPGGNDNYLTITGPSHLFLSGAETFHTPSLGDEEFEIPPISLDSDPSLAVSDVVDHFD
DLADPSSSQDGSASAQYGVQTLDMLCGHDPRLDGARWGLLSGGLIMDLNHSIGTQYSANP
PVTIDVLMIDMTSDLMGHSQLTTIDQSELSFQLGLSLRGGTILPPAQSPEDRISTTPSPT
SSLHEVGVEDFRRQISSQKTVVVEAGKKQKVPKKRKKKDPNEPQKPVSAYALFFHDTRAA
IKGQNPNATFGEVSKIVASMWDSLGEEQKQIYKRKTEAAKKEYLKTLAAYKDNQECQATV
ETAELDPAPPSQTPSPPPMATVDPASPAPASTEPPALSPSIIGAGGQPNITKLIITKQTL
PSSITMSQGGMVTAILATVVTSWRLQLGQTSTATIQPSQQAQIVTWSVLQAAAAAATVAS
MQLPPPRLQPMPQPLTQQQVTILQQPPPLQAMQQPPPQKVRINLQQQLPPLQIKSVPPLT
LKMQTTLVPPTVESSPERPMNNSPEAHTVEATSPETICEMITDVVPEVESSSEMDVELVS
GSPVALSPQPRCVMSGCENPPIVSKDWDNECCSNECVVKHCRDVFLAWIASRNSNTVVFV
K
Download sequence
Identical sequences ENSGGOP00000025810 ENSGGOP00000025810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]