SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025813 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025813
Domain Number 1 Region: 21-49,97-169
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.53e-25
Family Voltage-gated potassium channels 0.0046
Further Details:      
 
Domain Number 2 Region: 278-362
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.53e-21
Family Voltage-gated potassium channels 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025813   Gene: ENSGGOG00000027386   Transcript: ENSGGOT00000029394
Sequence length 384
Comment pep:known_by_projection chromosome:gorGor3.1:10:131176389:131195958:1 gene:ENSGGOG00000027386 transcript:ENSGGOT00000029394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEISGHPQARRCCPEALGKLFPGLCFLCFLVTYALVGAVLFSAIEDGQVLVAADDGEFEK
FLEELCRILNCSETVVQDRKQDLQGHLQKVKPQWFNRTTHWSFLSSLFFCCTVFSTVGYG
YIYPVTRLGKYLCMLYALFGIPLMFLVLTDTGDILATILSTSYNRFRKFPFFTCPLLSKG
CPKSLFKKKPDPKPTDEAVPQIIISAEELPGPKLGTCPLRPSCSMELLERPHAREKQNTL
QLPPQAMERSNSCPELVLGRLSYSIISNLDEVGQQVERLDIPLPIIALIVFAYISCAAAI
LPFWETQLDFENAFYFCFVTLTTIGFGDTVLEHPNFFLFFSIYIIIGMEIVFIAFKLVQN
RLIDIYKNVMLFFAKGKFYHLVKK
Download sequence
Identical sequences G3SCI5
ENSGGOP00000025813 XP_004050209.1.27298 ENSGGOP00000025813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]