SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025881 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025881
Domain Number 1 Region: 163-272
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 3.06e-32
Family ProC C-terminal domain-like 0.0011
Further Details:      
 
Domain Number 2 Region: 1-162
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 4.13e-28
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025881   Gene: ENSGGOG00000013977   Transcript: ENSGGOT00000023462
Sequence length 321
Comment pep:known_by_projection chromosome:gorGor3.1:5:1246565:1251266:1 gene:ENSGGOG00000013977 transcript:ENSGGOT00000023462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSALRKMGVKLTPHNKETV
QHSDVLFLAVKPHIIPFILDEIGADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRC
MTNTPVVVREGATVYATGTHAQVEDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAY
AFTALDALADGGVKMGLPRRLAVRLGAQALLLQGAAKMLLHSEQHPGQLKDNVSSPGGAT
IHALHVLESGGFRSLLINAVEASCIRTRELQSMADQEQVSPAAIKKTILDKVKLDSPAGT
SLSPSGHIKLLPRSLAPAGKD
Download sequence
Identical sequences ENSGGOP00000025881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]