SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025890 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000025890
Domain Number - Region: 55-163
Classification Level Classification E-value
Superfamily SMAD MH1 domain 0.0275
Family SMAD MH1 domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025890   Gene: ENSGGOG00000006557   Transcript: ENSGGOT00000023808
Sequence length 501
Comment pep:known_by_projection chromosome:gorGor3.1:19:3422016:3522736:1 gene:ENSGGOG00000006557 transcript:ENSGGOT00000023808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLQDEFHPFIEALLPHVRAFAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLGEKPE
VKQKWASRLLAKLRKDIRPECREDFVLSITGKKAPGCVLSNPDQKGKMRRIDCLRQADKV
WRLDLVMVILFKGIPLESTDGERLVKAAQCGHPVLCVQPHHIGVAVKELDLYLAYFVRER
DAEQSGSPRTGMGSDQEDSKPITLDTTDFQESFVTSGVFSVTELIQVSRTPVVTGTGPNF
SLGELQGHLAYDLNPASTGLRRTLPSTSSSGSKRHKSGSMEEDVDTSPGGDYYTSPSSPT
SSSRNWTEDMEGGISSPVKKTEMDKSPFNSPSPQDSPRLSSFTQHHRPVIAVHSGIARSP
HPSSALHFPTTSILPQTASTYFPHTAIRYPPHLNPQDPLKDLVSLACDPASQQPGPLNGS
GQLKMPSHCLSAQMLAPPPPGLPRLALPPATKPATTSEGGATSPTSPSYSPPDTSPANRS
FVGLGPRDPAGIYQAQAWGGS
Download sequence
Identical sequences ENSGGOP00000025890 ENSGGOP00000020409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]