SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025901 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025901
Domain Number 1 Region: 125-282
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.66e-34
Family Dual specificity phosphatase-like 0.000061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025901   Gene: ENSGGOG00000004523   Transcript: ENSGGOT00000030303
Sequence length 1151
Comment pep:known_by_projection chromosome:gorGor3.1:1:146260916:146295075:1 gene:ENSGGOG00000004523 transcript:ENSGGOT00000030303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATRKDTEEEQVVPSEEDEANVRAVQAHYLRSPSPSQYSMVSDAETESIFMEPIHLSSAI
AAKQIINEELKPRGVRADAECPGMLESAEQLLVEDLYNRVREKMDDTSLYNTPCVLDLQR
ALVQDRQEAPWNEVDEVWPSVFIAEKSVAVNKGRLKRLGITHILNAAHGTGVYTGPEFYT
GLEIQYLGVEVDDFPEVDISQHFRKAAEFLDEALLTYRGKVLVSSEMGISRSAVLVVAYL
MIFHNMAILEALMTVRKKRAIYPNDGFLKQLRELNEKLMEEREEDYGREGGSAEAEEGEG
TGSMLGARVHALTVEEEDDSASHLSGSSLGKATQASKPLTLIDEEEEEKLYEQWKKGQGL
LSDKVPQDGGGWRSASSGQGGEELEDEDVERIIQEWQSRNERYQAEGYRRWGSDAGSSVG
RRRRTLSESSAWESVSSHDIWVLKQQLELNRPDHGRRRRADSMSSESTWDAWNERLLEIE
KEASRRYHAKSKKEEAADRSSEAGSRVREDDEDSVGSEASSFYNFCSRNKDKLTALERWK
IKRIQFGFHKKDLGAGDSSSEPGAEEAVGEKKNPSDVSLTAYQAWKLTHQKKVGSENKQE
VVELSKGEDSALAKKRQRRLELLERSRQTLEESQSMASWEADSSTASGSIPLSAFWSAAP
SVSADGDTTSVLSTQSHRSHLSQAASNIAGCSTSNPTTPLPNLPVGPGDTISIASIQNWI
ANVVSETLAQKQNEMLLLSRSPSVASMKAVPAASCLGDDQVSMLSGQSSSSLGGCLLPQS
QARPSSAMQSVLSCNTTLSSPAESCRSKVRGTSKPIFSLFVDNVDLKELGRKEKEMQMEL
REKMSEYKMEKLASDNKRSSLFKKKKVKEDEDDGVGDGDEDTDSAIGSFRYSSRSNSQKP
ETDTCSSLAVCDHYASGSRVGKEMDSSINKWLSGLRTEEKPPFQSDWSGSSRGKYTRSSL
LRETESKSSSYKFSKSQSEEQDTSSYHEVNGNSVRSTSRFSSSSTREGREMHKFSRSTYN
ETSSSREESPEPYFFRRTPESSEREESPEPQRPNWARSRDWEDVEESSKSDFSEFGAKRK
FTQSFMRSEEEGEKERTENREEGRFASGRRSQYRRSTDREEEEEMDDEAIIAAWRCRQEE
TRTKLQKRRED
Download sequence
Identical sequences ENSGGOP00000025901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]