SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025918 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025918
Domain Number 1 Region: 34-329
Classification Level Classification E-value
Superfamily L domain-like 7.37e-56
Family Ngr ectodomain-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025918   Gene: ENSGGOG00000026152   Transcript: ENSGGOT00000024612
Sequence length 512
Comment pep:known_by_projection chromosome:gorGor3.1:10:79363874:79365733:1 gene:ENSGGOG00000026152 transcript:ENSGGOT00000024612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFNVIRLLSGSAVALVIAPTVLLTMLSSAERGCPKGCRCEGKMVYCESQKLQEIPSSIS
AGCLGLSLRYNSLQKLKYNQFKGLNQLTWLYLDHNHISNIDENAFNGIRRLKELILSSNR
ISYFLNNTFRPVTNLRNLDLSYNQLHSLGSEQFRGLRKLLSLHLRSNSLRTIPVRIFQDC
RNLELLDLGYNRIRSLARNVFAGMIRLKELHLEHNQFSKLNLALFPRLVSLQNLYLQWNK
ISVIGQTMSWTWSSLQRLDLSGNEIEAFSGPSVFQCVPNLQRLNLDSNKLTFIGQEILDS
WISLNDISLAGNIWECSRNICSLVNWLKSFKGLRENTIICASPKELQGVNVIDAVKNYSI
CGKSTTERFDLARALPKPTFKPKLPRPKHESKPPLPPTVGATEPGPETDADAEHISFHKI
IAGSVALFLSVLVILLVIYVSWKRYPASMKQLQQRSLMRRHRKKKRQSLKQMTPSTQEFY
VDYKPTNTETSEMLLNGTGPCTYNKSGSRECE
Download sequence
Identical sequences ENSGGOP00000025918 ENSGGOP00000025918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]