SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025929 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025929
Domain Number 1 Region: 438-497
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.05e-17
Family Erythroid transcription factor GATA-1 0.00051
Further Details:      
 
Domain Number 2 Region: 385-434
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000523
Family Erythroid transcription factor GATA-1 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025929   Gene: ENSGGOG00000024673   Transcript: ENSGGOT00000026879
Sequence length 596
Comment pep:known_by_projection chromosome:gorGor3.1:18:19165823:19197123:1 gene:ENSGGOG00000024673 transcript:ENSGGOT00000026879 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALTDGGWCLPKRFGAAGADASDSRAFPAREPSTPPSPISSSSSSCSRGGERGPGGASNC
GTPQLDTEAAAGLPARSLLLSSYASHPFGAPHGPSAPGVAGPGGNLSSWEDLLLFTDLDQ
AATASKLLWSSRGAKLSPFAPEQPEEMYQTLAALSSQGPAAYDGAPGGFVHSAAAAAAAA
XXXXXXXXXXXXXTRVGSMLPGLPYHLQGSGSGPANHAGGAGAHPGWPQASADSPPYGGG
GGAAGGGAAGPGGAGSAAAHVSARFPYSPSPPMANGAAREPGGYAAAGSGGAGGVSGGGS
SLAAMGGREPQYSSLSAARPLNGTYHHHHHHHHHPSPYSPYVGAPLTPAWPAGPFETPVL
HSLQSRAGAPLPVPRGPSADLLEDLSESRECVNCGSIQTPLWRRDGTGHYLCNACGLYSK
MNGLSRPLIKPQKRVPSSRRLGLSCANCHTTTTTLWRRNAEGEPVCNACGLYMKLHGVPR
PLAMKKEGIQTRKRKPKNINKSKTCSGNSSNSIPMTPTSTSSNSDDCSKNTSPTTQPTAS
GAGAPVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRQDSWCALALA
Download sequence
Identical sequences G3RZ55
ENSGGOP00000021097 XP_004059281.1.27298 XP_018869856.1.27298 ENSGGOP00000025929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]