SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025939 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000025939
Domain Number - Region: 150-235,265-322
Classification Level Classification E-value
Superfamily Glycerol-3-phosphate (1)-acyltransferase 0.00811
Family Glycerol-3-phosphate (1)-acyltransferase 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025939   Gene: ENSGGOG00000008876   Transcript: ENSGGOT00000030503
Sequence length 338
Comment pep:known_by_projection chromosome:gorGor3.1:2b:111667764:111690451:1 gene:ENSGGOG00000008876 transcript:ENSGGOT00000030503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAVDKSLGVEMNPRLETAVCYRRVFMYILLLACFWPMSIGITVMLIIHNYSFLYIPYLMW
LYFDWHTPERGGRRSSWIKNWTLWKHFKDYFPIHLIKTQDLDPSHNYIFGFHPHGIMAVG
AFGNFSINYSDFKDLFPGFTSYLHVLPLWFWCPVFREYVMSVGLVSVSKKSVSYMVSKEG
GGNISVIVLGGAKESLDAHPGKFTLFIRQWKGFVKIALTHGASLVPVVSFGENELFKQTD
NPEGSWIRTVQNKLHKIMGFALPLFHARGVFQYNFGVMPYRKAIHTVVGRPIPVRQTLNP
TQEQIEELHQTYMEELRKLFEERKGKYGVPEHETLVLK
Download sequence
Identical sequences ENSGGOP00000028437 ENSGGOP00000025939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]