SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025946 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025946
Domain Number 1 Region: 330-440
Classification Level Classification E-value
Superfamily SH2 domain 2.15e-20
Family SH2 domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025946   Gene: ENSGGOG00000001032   Transcript: ENSGGOT00000034070
Sequence length 456
Comment pep:known_by_projection chromosome:gorGor3.1:10:109528071:109610847:-1 gene:ENSGGOG00000001032 transcript:ENSGGOT00000034070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKLNKITVPASQKLRQLQKMVHDIKNNEGGIMNKIKKLKVKAPPSVPRRDYASESPADE
EEQWSDDFDSDYENPDEHSDSEMYVMPAEENADDSYEPPPVEQETRPVHPALPFARGEYI
DNRSSQRHSPPFSKTLPSKPSWPSEKARLTSTLPALTALQKPQVPPKPKGLLEDEADYVV
PVEDNDENYIHPTESSSPPPEKAPIVNRSTKPNSSTPASPPGTASGRNSGAWETKSPSPA
APSPLPRAGKKPTTPLKTTPVASQQNASSVCEEKPIPAERHRGSSHRQEAVQSPVFPPAQ
KQIHQKPIPLPRFTEGGNPTVDGPLPSFSSNSTISEQEAGVLCKPWYAGACDRKSAEEAL
HRSNKDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRFIEATKQYALGRKKNGEEYFG
SVAEIIKNHQHSPLVLIDSQNNTKDSTRLKYAVKVS
Download sequence
Identical sequences G3SCW8
ENSGGOP00000025946 XP_004049898.1.27298 ENSGGOP00000001016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]