SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025955 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025955
Domain Number 1 Region: 459-668
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.24e-34
Family Laminin G-like module 0.00000000341
Further Details:      
 
Domain Number 2 Region: 255-445
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.02e-29
Family Laminin G-like module 0.000000083
Further Details:      
 
Domain Number 3 Region: 46-103
Classification Level Classification E-value
Superfamily GLA-domain 4.04e-20
Family GLA-domain 0.00065
Further Details:      
 
Domain Number 4 Region: 142-273
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000091
Family Growth factor receptor domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025955   Gene: ENSGGOG00000017166   Transcript: ENSGGOT00000023586
Sequence length 673
Comment pep:known_by_projection chromosome:gorGor3.1:13:96996537:97041365:1 gene:ENSGGOG00000017166 transcript:ENSGGOT00000023586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RQPPPGETLLFRNTLLLLLLAAECALAALLPAREATQFLRPRQRRAFQVFEEAKQGHLER
ECVEELCSREEAREVFENDPETDYFYPRYLDCINKYGSPYTKNSGFATCVQNLPDQCTPN
PCDRKGTQACQVARGCAPLGSPSGLCLFPDVNECSQENGGCLQICHNKPGSFHCSCHSGF
ELSSDGRTCQDIDECADSEACGEARCKNLPGSYSCLCDEGFAYSSQEKACRDVDECLQGR
CEQVCVNSPGSYTCHCDGRGGLKLSQDMDTCEDILPCVPFSVAKSVKSLYLGRMFSGTPV
IRLRFKRLQPTRLVAEFDFRTFDPEGILLFAGGHQDSTWIVLALRAGRLELQLRYNGVGR
VTSSGPVINHGMWQTVSVRQPQRGLECNLKKDIFLKLRGGSGGLPEIGTLLAHLRGGSGG
LPETGTLLAQTINPRLDGCMRSWNWLNGEDTTIQETVKVNTRMQCFSVTERGSFYPGSGF
AFYSLDYMRTPLDVGTESAWEIEVVAHIRPAADTGVLFALWVPDLRAVPLSVALVDYHST
KKLKKQLVVLAVEHVALALMEIKVCDGQEHVVTVSLRDGEATLEVDGTRGQSEVSAAQLQ
ERLAVLERHLRSPVLTFAGGLPDVPVTSAPVTAFYRGCMTLEVNRRPLDLDEAAYKHSDI
TAHSCPPVEPAAA
Download sequence
Identical sequences ENSGGOP00000025955 ENSGGOP00000016753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]