SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025977 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025977
Domain Number 1 Region: 446-601
Classification Level Classification E-value
Superfamily Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain 6.02e-60
Family Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain 0.0000000657
Further Details:      
 
Domain Number 2 Region: 16-361
Classification Level Classification E-value
Superfamily RNI-like 1.33e-53
Family Rna1p (RanGAP1), N-terminal domain 0.0000254
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025977   Gene: ENSGGOG00000013473   Transcript: ENSGGOT00000022397
Sequence length 602
Comment pep:known_by_projection chromosome:gorGor3.1:22:25592379:25633742:-1 gene:ENSGGOG00000013473 transcript:ENSGGOT00000022397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRSPGEPTSLVNMASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDF
DSMEALRLEGNTVGVEAARVIAKALEKKSELKRCHWSDMFTGRLRTEIPPALISLGEGLI
TAGAQLVELDLSDNAFGPDGVQGFEALLKSSACFTLHELKLNNCGMGIGGGKILAAALTE
CHRKSSAQGKPLALKVFVAGRNRLENDGATALAEAFRVIGTLEEVHMPQNGINHPGITAL
AQAFAVNPLLRVINLNDNTFTEKGAVAMAETLKTLRQVEVINFGDCLVRSKGAVAIADAI
RGGLPKLKELNLSFCEIKRDAALAVAEAMADKAELEKLDLNGNTLGEEGCEQLQEVLEGF
NMAKVLASLSDADSRKEVTVGPGESTWRRRWVAGERPSPGSKEDLLQPALSAPQQRGQGE
KSATPSRKILDPNSGEPAPVLSSPCPADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSD
PEKVVSAFLKVSSVFKDEATVRTAVQDAVDALMQKAFSSSSFDSNTFLTRLLVHMGLLKS
EDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFMTKPNSALESCSFARHSLLQTLY
KV
Download sequence
Identical sequences ENSGGOP00000013146 ENSGGOP00000025977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]