SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026015 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026015
Domain Number 1 Region: 18-154
Classification Level Classification E-value
Superfamily C-type lectin-like 7.35e-25
Family C-type lectin domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026015   Gene: ENSGGOG00000008295   Transcript: ENSGGOT00000024908
Sequence length 232
Comment pep:known_by_projection chromosome:gorGor3.1:2b:47357198:47385799:-1 gene:ENSGGOG00000008295 transcript:ENSGGOT00000024908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRAALPALLLPLLGLAAAAVADCPSSTWIQFQDSCYIFLQEAIKVESIEDVRNQCTDHG
ADMISIHNEEENAFILDTLKKQWKGPDDILLGMFYDTDDASFKWFDNSNMTFDKWTDQDD
DEDLVDTCAFLHIKTGEWKKGNCEVSSVEGTLCKTAIPYKRKYLSDNHILISALVIASTV
ILTVLGAIIWFLYKKHSDSRFTTVFSTAPQSPYNEDCVLVVGEENEYPVQFD
Download sequence
Identical sequences A0A2I2YC90 Q8IX05
NYSGRC-LECT-ENSP00000259053 gi|26892293|ref|NP_055695.2| ENSGGOP00000026015 ENSP00000259053 9606.ENSP00000259053 NP_055695.2.87134 NP_055695.2.92137 XP_004032735.1.27298 ENSP00000259053 ENSP00000259053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]