SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026056 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026056
Domain Number 1 Region: 326-387
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 1.83e-24
Family Delta-sleep-inducing peptide immunoreactive peptide 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026056   Gene: ENSGGOG00000028315   Transcript: ENSGGOT00000026687
Sequence length 395
Comment pep:known_by_projection chromosome:gorGor3.1:7:97959823:97973167:-1 gene:ENSGGOG00000028315 transcript:ENSGGOT00000026687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGGKKKSSFQITSVTTDYEGPGSPGASDPPTPQPPTGPPPRLPNGEPSPDPGGKGTPRN
GSPPPGAPSSRFRVVKLPHGLGEPYRRGRWTCVDVYERDLEPHSFGRLLEGIRGASGGAG
GRSLDSRLELASLGLGAPTPQSGLSQGPTSWLRPPPTSPGPQARSFTGGLGQLVVPGKAK
AEKPPLSASPPQQRPPEPETGESAGTSRAATPLPSLRVEAEAGGSGARTPPLSRRKAVDM
RLRMELGAPEEMGQVPPLDSRPSSPALYFAHDASLVHKSPDPFGAVAAQKFSLAHSMLAI
SGHLDSDDDSGSGSLVGIDNKIEQAMDLVKSHLMFAVREEVEVLKEQIRELAERNAALEQ
ENGLLRALASPEQLAQLPSSGVPRLGPPAPNGPSV
Download sequence
Identical sequences G3SD77
XP_004045954.1.27298 XP_018886971.1.27298 ENSGGOP00000026056 ENSGGOP00000026056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]