SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026058 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026058
Domain Number 1 Region: 1-76
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000088
Family SAM (sterile alpha motif) domain 0.0000171
Further Details:      
 
Domain Number 2 Region: 389-450
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000106
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 3 Region: 176-275
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000401
Family PDZ domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026058   Gene: ENSGGOG00000006575   Transcript: ENSGGOT00000025886
Sequence length 668
Comment pep:known_by_projection chromosome:gorGor3.1:1:27101007:27113030:1 gene:ENSGGOG00000006575 transcript:ENSGGOT00000025886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPVETWTPGKVATWLRGLDDSLQDYPFEDWQLPGKNLLQLCPRSLEALAVRSLGHQELI
LGGVEQLQALSSRLQTENLQSLTEGLLGATHDFQSIVQGCLGDCAKTPIDVLCAAVELVH
EADALLFWLSRYLFSHLNDFSACQEIRDLLEELSQVLHEDGPAAEKEGTVLRICSHVAGI
CHNILVCCPKELLEQRAVLEQVQLDSPLGLEIHTTSNFQHFVSQVDTQVPTDSRLQIQPG
DEVVQINEQVVVGWPRKNMVRELLREPAGLSLVLKKIPIPETPPQTPPQVLDSPHQRSPS
LSLAPLSPRAPSEDVFAFDLSSNPSPGPSPAWAPLFFLAVSLISLAPLHPLATSPTLTPD
SSPELQKQRDLLESPGDAFSSPQPSGARGPQDEKAEGLINVSSYSLESGHDQKKKYVFQL
THDVYKPFIFAADTLTDLSMWVRHLITCISKYQSPGRAPPPREEDCYSETEAEDPDDEAG
SHSASPSPAQAGSPLHGDTSPAATPTQRSTWTSFGSLTDSSEEALEGMVRGLRQGGVSLL
GQPQPLTQEQWRSSFMRRNRDPQLNERVHRVRALQSTLKAKLQELQVLEEVLGDPELTGE
KFRQWKEQNRELYSEGLGAWGVAQAEGSSHILTSDSTEQSPHSLPSDPEEHSHLCPLTSE
SSLRPPDL
Download sequence
Identical sequences ENSGGOP00000006436 ENSGGOP00000026058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]