SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026075 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026075
Domain Number 1 Region: 746-961
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-106
Family Thrombospondin C-terminal domain 0.000000101
Further Details:      
 
Domain Number 2 Region: 619-744
Classification Level Classification E-value
Superfamily TSP type-3 repeat 9.42e-35
Family TSP type-3 repeat 0.00000517
Further Details:      
 
Domain Number 3 Region: 235-280
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 2.35e-17
Family Assembly domain of cartilage oligomeric matrix protein 0.001
Further Details:      
 
Domain Number 4 Region: 550-621
Classification Level Classification E-value
Superfamily TSP type-3 repeat 3.14e-16
Family TSP type-3 repeat 0.00025
Further Details:      
 
Domain Number 5 Region: 64-172
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000155
Family Laminin G-like module 0.022
Further Details:      
 
Domain Number 6 Region: 500-561
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000667
Family TSP type-3 repeat 0.00021
Further Details:      
 
Domain Number 7 Region: 390-430
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000392
Family EGF-type module 0.012
Further Details:      
 
Domain Number 8 Region: 308-362
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000469
Family EGF-type module 0.029
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000026075
Domain Number - Region: 440-482
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00527
Family EGF-type module 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026075   Gene: ENSGGOG00000027002   Transcript: ENSGGOT00000030517
Sequence length 979
Comment pep:known_by_projection chromosome:gorGor3.1:17:17558773:17606799:-1 gene:ENSGGOG00000027002 transcript:ENSGGOT00000030517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGPTPPSPPASRGAGRANMLAPRGAAVLLLHLVLQRWLAAGAQATPQVFDLLPSSSQRLN
PGVLLPVLTDPALNDLYVISTFKLQTKSSATIFGLYSSTDNSKYFEFTVMGRLNKAILRY
LKNDGKVHLVVFNNLQLADGRRHRILLRLSNLQRGAGSLELYLDCIQVDSIHNLPRAFAG
PSQKPETIELRTFQRKPQDFLEELKLVVRGSLFQVASLQDCFLQQSEPLAATGTGDFNRQ
FLGQMIQLNQLLGEVKDLLRQQVKETSFLRNTIAECQACGPLKFQSPTPSTVVPPAPPAP
PTRPPRRCDSNPCFRGVQCTDGRDGFQCGPCPEGYTGNGITCIDVDECKYHPCYPGVRCI
NLSPGFRCDACPVGFTGPMVQGVGISFAKSNKQVCTDIDECRNGACVPNSICVNTLGSYR
CGPCKPGYTGDQIRGCKAERNCRNPELNPCSVNAQCIEERQGDVTCVCGVGWAGDGYICG
KDVDIDSYPDEELPCSARNCKKDNCKYVPNSGQEDADRDGIGDACDEDADGDGILNEQDN
CVLIHNVDQRNSDKDIFGDACDNCLSVLNNDQKDTDGDGRGDACDDDMDGDGIKNILDNC
PKFPNRDQRDKDGDGVGDACDSCPDVSNPNQSDVDNDLVGDSCDTNQDSDGDGHQDSTDN
CPTVINSAQLDTDKDGIGDECDDDDDNDGIPDLVPPGPDNCRLVPNPAQEDSNSDGVGDI
CESDFDQDQVIDRIDVCPENAEVTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQT
MNSDPGLAVGYTAFNGVDFEGTFHVNTQTDDDYAGFIFGYQDSSSFYVVMWKQTEQTYWQ
ATPFRAVAEPGIQLKAVKSKTGPGEHLRNSLWHTGDTSDQVRLLWKDSRNVGWKDKVSYR
WFLQHRPQVGYIRVRFYEGSELVADSGVTIDTTMRGGRLGVFCFSQENIIWSNLKYRCND
TIPEDFQEFQTQNFDRFDN
Download sequence
Identical sequences ENSGGOP00000026075 ENSGGOP00000026075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]