SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026079 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026079
Domain Number 1 Region: 23-267,336-382
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.99e-90
Family Type II chitinase 0.000000227
Further Details:      
 
Domain Number 2 Region: 263-331
Classification Level Classification E-value
Superfamily Chitinase insertion domain 1.01e-19
Family Chitinase insertion domain 0.00031
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000026079
Domain Number - Region: 459-525
Classification Level Classification E-value
Superfamily Adhesin YadA, collagen-binding domain 0.0955
Family Adhesin YadA, collagen-binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026079   Gene: ENSGGOG00000005204   Transcript: ENSGGOT00000029448
Sequence length 678
Comment pep:known_by_projection chromosome:gorGor3.1:1:114390337:114403835:-1 gene:ENSGGOG00000005204 transcript:ENSGGOT00000029448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWKLLLWVGLVLVLQHHDGAAHKLVCYFTNWAHSRPGPASILPHDLDPFLCTHLIFAFAS
MNNNQIVAKDLQDEKILYPEFNKLKERNRELKTLLSIGGWNFGTSRFTTMLSTFANREKF
IASVISLLRTHDFDGLDLFFLYPGLRGSPMHDRWTFLFLIEELLFAFRKEALLTMRPRLL
LSAAVSGVPHIVQTSYDVRFLGRLLDFINVLSYDLHGSWERFTGHNSPLFSLPEDPKSSA
YAMNYWRKLGAPSEKLIMGIPTYGRTFRLLKASKNGLQARAIGPASPGKYTKQEGFLAYF
EICSFVWGAKKHWIDYQYVPYANKGKEWVGYDNAISFSYKAWFIRREHFGGAMVWTLDMD
DVRGTFCGTGPFPLVYVLNDILVRAEFSSTSLPQFWLSSAVNSSSTDPERLAVTTAWTTD
SKILPPGGEAGVTEIHGKCENMTITPRSTTVTPTKETVSLGKHTVALGEKTEITGATTMT
SVGHQSMTPGEKALTPVGHQSVTTGQKTLTSVGYQSVTPGEKTLTPVGHQSVTPVSHQSV
SPGGTTMTPVHFQTETLRQNTVAPRRKAVAREKVTVPSRNISVTSEGQTMPLRGENLTSE
VGTHPRMGNLGLQMEAENRMMLSSSPVIQLPEHTPLAFDNRFVPIYGNHSSVNSVTPQTS
PLSLKKEIPENSAVDQEA
Download sequence
Identical sequences G3SD99
ENSGGOP00000026079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]