SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026088 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000026088
Domain Number - Region: 118-173
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0684
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026088   Gene: ENSGGOG00000024080   Transcript: ENSGGOT00000030343
Sequence length 218
Comment pep:known_by_projection chromosome:gorGor3.1:22:22282636:22291361:-1 gene:ENSGGOG00000024080 transcript:ENSGGOT00000030343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASQKQMEVVTKGTGFRRRPKTTTYTPGTCELLRELKDERRMRGRFKVLHLAKSQRRGDA
LPLQCSPTSSQRVLPSKQIASPIYLPPILAARPHLRPANMCQANGAYSREQFKPQATRDL
EKEKQRLQNIFATGKDLEERKRKAPPARQKAPAPELDRFEELVKEIQERKEFLADMEALG
QGKQYRGIILAEISQKLREMEDIDHRRSEELRKGLATT
Download sequence
Identical sequences ENSGGOP00000026088 ENSGGOP00000020613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]