SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026092 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026092
Domain Number 1 Region: 2167-2425
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.12e-94
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000308
Further Details:      
 
Domain Number 2 Region: 665-773
Classification Level Classification E-value
Superfamily Second domain of FERM 2.75e-33
Family Second domain of FERM 0.0002
Further Details:      
 
Domain Number 3 Region: 1074-1182
Classification Level Classification E-value
Superfamily PDZ domain-like 4.21e-27
Family PDZ domain 0.0073
Further Details:      
 
Domain Number 4 Region: 775-881
Classification Level Classification E-value
Superfamily PH domain-like 2.37e-26
Family Third domain of FERM 0.0022
Further Details:      
 
Domain Number 5 Region: 1351-1463
Classification Level Classification E-value
Superfamily PDZ domain-like 7.1e-25
Family PDZ domain 0.0000136
Further Details:      
 
Domain Number 6 Region: 1788-1877
Classification Level Classification E-value
Superfamily PDZ domain-like 8.28e-22
Family PDZ domain 0.015
Further Details:      
 
Domain Number 7 Region: 1497-1600
Classification Level Classification E-value
Superfamily PDZ domain-like 4.07e-20
Family PDZ domain 0.028
Further Details:      
 
Domain Number 8 Region: 1879-1970
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-17
Family PDZ domain 0.041
Further Details:      
 
Domain Number 9 Region: 571-664
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.76e-17
Family First domain of FERM 0.014
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000026092
Domain Number - Region: 2-161
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000381
Family Protein kinases, catalytic subunit 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026092   Gene: ENSGGOG00000025765   Transcript: ENSGGOT00000029308
Sequence length 2440
Comment pep:known_by_projection chromosome:gorGor3.1:4:95560925:95749703:1 gene:ENSGGOG00000025765 transcript:ENSGGOT00000029308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHVSLAEALEVRGGPLQEEEIWAVLNQSAESLQELFRKVSLTDPAALGFIISPWSLLLLP
SGSVSFTDENISNQDLRAFTAPEVLQNQSLTSLSDVEKIHIYSLGMTLYWGADYEVPQSQ
PIKLGDHLNSILLGMCEDVIYARVSVRTVLDACSAHIRNSNCAPSFSYVKHLVKLVLGNL
SGTDQLSCNSEQKPDRSQAIRDRLRGKGLPTGRSSTSDVLDIQKPPLSHQTFLNKGLSKS
MGFLSIKDTQDEDYFKDILSDNSGHEDSENTCSPYQFKTSGPEKKPIPGIDVLSKKKIWA
SSMDLLCTADRDFSSGETATYRRCHPEAVTVRTSTTPRKKEARYSDGSIALDIFGPQKMD
PIYHTRELPTSSAISSALDRIRERQKKLQVLREAMNVEEPVRRYKTYHGDAFSTSSESPS
IISSESDFRQVRRSEASKRFESSSGLPGVDETLSQGQSQRPSRQYETPFEGNLINQEIML
KRQEEELMQLQAKMALRQSRLSLYPGDTIKASMLDITRDPLREIALETAMTQRKLRNFFG
PEFVKMTIEPFISLDLPRSILTKKGKNEDNRRKVNIMLLNGQRLELTCDTKTICKDVFDM
VVAHIGLVEHHLFALATLKDNEYFFVDPDLKLTKVAPEGWKEEPKKKTKATVNFTLFFRI
KFFMDDVSLIQHTLTCHQYYLQLRKDILEERMHCDDETSLLLASLALQAEYGDYQPEVHG
VSYFRMEHYLPARVMEKLDLSYIKEELPKLHNTYVGASEKETELEFLKVCQRLTEYGVHF
HRVHPEKKSQTGILLGVCSKGVLVFEVHNGVRTLVLRFPWRETKKISFSKKKITLQNTSD
GIKHAFQTDNSKICQYLLHLCSYQHKFQLQMRARQSNQDAQDIERASFRSLNLQAESVRG
FNMGRAISTGSLASSTLNKLAVRPLSVQAEILKRLSCSELSLYQPLQNSSKEKNDKASWE
EKPREMSKSYHDLSQASLYPHRKNVVVNMEPPPQTVAELVGKPSHQMSRSDAESLAGVTK
LNNSKSVASLNRSPERRKHESDSSSIEDPGQAYVLGMTMHSSGNSSSQVPLKENDVLHKR
WSIVSSPEREITLVNLKKDAKYGLGFQIIGGEKMGRLDLGIFISSVAPGGPADLDGCLKP
GDRLISVNSVSLEGVSHHAAIEILQNAPEDVTLVISQPKEKISKVPSTPVHLTNEMKNYM
KKSSYVQDSAIDSSSKDHHWSRGTLRHISENSFGLSGGLREGSLSSQDSRTESASLSQSQ
VNGFFASHLGDQTWQESQHGSPSPSVISKATEKETFTDSNQSKTKKPGISDATDYSDRGD
SDMDEATYSSSQDHQTPKQESSSSVNTSNKMNFKTFSSSPPKPGDIFEVELAKNDNSLGI
SVTVLFDKGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAV
ETLRNTGQVVHLLLEKGQSPTSKEHVLVTPQCTLSDQNAQGQGPEKVKKTTQVKDYSFVT
EENTFEVKLFKNSSGLGFSFSREDNLIPEQINASIVRVKKLFPGQPAAESGKIDVGDVIL
KVNGASLKGLSQQEVISALRGTAPEVFLLLCRPPPGVLPEIDTALLTPLQSPAQVLPNSS
KDSSQPSCVEQSTSSDENEMSDKSKKQCKSPSRRDSYSDSSGSGEDDLVTAPANISNSTW
SSALHQTLSNMVSQAQSHREAPKSQEDTICTMFYYPQKIPNKPEFEDSNPSPLPPDMAPG
QSYQPQSESASSSSMDKYHIHHISEPTRQENWTPLKNDLENHLKDFELEVELLITLIKSE
KGSLGFTVTKGNQRIGCYVHDVIQDPAKSDGRLKPGDRLIKVNDTDVTNMTHTDAVNLLR
AASKTVRLVIGRVLELPRIPMLPHLLPDITLTCNKEELGFSLCGGHDSLYQVVYISDINP
RSVAAIEGNLQLLDVIHYVNGVSTQGMTLEEVNRALDMSLPSLVLKATRNDLPVVPSSKR
SAVSAPKSTKGNGSYSVGSCSQPALTPNDSFSTVAGEEINEISYPKGKCSTYQIKGSPNL
TLSKESYIQEDDIYDDSQEAEVIQSLLDVVDEEAQNLLNENNAAGNSCGPGTLKMNGKLS
EERTEDTDCDGSPLPEYFTEATKMNGCEEYCEEKVKSESLIQKSQEKKTDDDEITWGNDE
LPIERTNHEDSDKNLQELKPLDQCLIGQTKENRRKNRYKNILPYDATRVPLGDEGGYINA
SFIKIPVGKEEFVYIACQGPLPTTVGDFWQMIWEQKSTVIAMMTQEVEGEKIKCQRYWPN
ILGKTTMVSNRLRLALVRMQQLKGFVVRAMTLEDIQTREVRHISHLNFTAWPDHDTPSQP
DDLLTFISYMRHIHRSGPIITHCSAGIGRSGTLICIDVVLGLISQDLDFDISDLVRCMRL
QRHGMVQTEDQYIFCYQVILYVLTRLQAEEEQKQQPQLLK
Download sequence
Identical sequences ENSGGOP00000026092 ENSGGOP00000026092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]