SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026096 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026096
Domain Number 1 Region: 90-331,359-441
Classification Level Classification E-value
Superfamily DNase I-like 5.1e-37
Family DNase I-like 0.053
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000026096
Domain Number - Region: 2-47
Classification Level Classification E-value
Superfamily L domain-like 0.000197
Family Ngr ectodomain-like 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026096   Gene: ENSGGOG00000003675   Transcript: ENSGGOT00000023161
Sequence length 458
Comment pep:known_by_projection chromosome:gorGor3.1:5:165144712:165171195:1 gene:ENSGGOG00000003675 transcript:ENSGGOT00000023161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RELHLNNNLLRVLPFELGKLFQLQTLGLKGNPLTQDILNLYQEPDGTRRLLNYLLDNLSG
TAKRITTEQPPPRSWIMLQEPDRTRPTALFSVMCYNVLCDKYATRQLYGYCPSWALNWDY
RKKAIIQEILSCNADIVSLQEVETEQYYSFFLVELKERGYNGFFSPKSRARTMSEQERKH
VDGCAIFFKTEKFTLVQKHTVEFNQLAMANSEGSEAMLNRVMTKDNIGVAVLLELRKESI
EMPSGKPHLGTEKQLILVANAHMHWDPEYSDVKLVQTMMFLSEVKNIIDKASRNLKSSVL
GEFGTIPLVLCADLNSLPDSGVVEYLSTGGVETNHKDFKELRYNESLTNFSCHGKNGTTN
GRITHGFKLQSAYESGLMPYTNYTFDFKGIIDYIFYSKPQLNTLGILGPLDHHWLVENNI
SGCPHPLIPSDHFSLFAQLELLLPFLPQVNGIHLPGRR
Download sequence
Identical sequences ENSGGOP00000026096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]