SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026111 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026111
Domain Number 1 Region: 249-311
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8e-19
Family Complement control module/SCR domain 0.005
Further Details:      
 
Domain Number 2 Region: 191-246
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000405
Family Complement control module/SCR domain 0.00079
Further Details:      
 
Domain Number 3 Region: 134-186
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000102
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 4 Region: 70-129
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000122
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 5 Region: 4-64
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000328
Family Complement control module/SCR domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026111   Gene: ENSGGOG00000012348   Transcript: ENSGGOT00000030797
Sequence length 312
Comment pep:known_by_projection chromosome:gorGor3.1:1:176441681:176673106:1 gene:ENSGGOG00000012348 transcript:ENSGGOT00000030797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVKPCDYPDIKHGSLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDYIHCTQNGWS
PAVPCLRKCYFPYLENGYNQNYGRKFVQGNSTEVACHPGYSLPKAQTTVTCTEKGWSPTP
RCIRINKCTKSDIEIENGFISESSSIYILNKEIQYKCKPGYATADGNSSGSITCLQNGWS
AQPICINSSEKCGPPPPISNGGTTSFLLKVYVPQSRVEYQCQSYYELQGSNYVTCSNGEW
SEPPRCIHPCIITEENMNKNNIKLKGRSDRKYYAKTGDTIEFMCKLGYNANTSILSFQAV
CREGIVEYPRCK
Download sequence
Identical sequences ENSGGOP00000026111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]