SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026114 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026114
Domain Number 1 Region: 6-151
Classification Level Classification E-value
Superfamily Globin-like 4.34e-55
Family Globins 0.000000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026114   Gene: ENSGGOG00000024137   Transcript: ENSGGOT00000031529
Sequence length 151
Comment pep:known chromosome:gorGor3.1:11:5225829:5227633:-1 gene:ENSGGOG00000024137 transcript:ENSGGOT00000031529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPGIMVHFTAEEKAAVTSLWSKMNVEEAGGEALGRLLVVYPWTQRFFDSFGNLSSPSAIL
GNPKVKAHGKKVLTSFGDAIKNMDNLKPAFAKLSELHCDKLHVDPENFKLLGNVMVIILA
THFGKEFTPEVQAAWQKLVSAVAIALAHKYH
Download sequence
Identical sequences ENSGGOP00000026114 ENSGGOP00000026114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]