SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026122 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026122
Domain Number 1 Region: 154-397,453-537
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.73e-94
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000015
Further Details:      
 
Domain Number 2 Region: 672-734
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000918
Family Ubiquitin-related 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026122   Gene: ENSGGOG00000009540   Transcript: ENSGGOT00000029196
Sequence length 1345
Comment pep:known_by_projection chromosome:gorGor3.1:11:12024846:12109604:1 gene:ENSGGOG00000009540 transcript:ENSGGOT00000029196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIENAAEEPRVLCIIQDTTNSKTVNERITLNLPASTPVRKLFEDVANKVGYINGTFDLVW
GNGINTADMAPLDHTSDKSLLDANFEPGKKNFLHLTDKDGEQPQILLLRDGGLGRMSPKS
SYFWKIPSKGKQGHKQSYTLPSLKWGIVWNRSSLKGYVGLVNQAMTCYLNSLLQTLFMTP
EFRNALYKWEFEESEEDPVTSIPYQLQRLFVLLQTSKKRAIETTDVTRSFGWDSSEAWQQ
HDVQELCRVMFDALEQKWKQTEQADLINELYQGKLKDYVRCLECGYEGWRIDTYLDIPLV
IRPYGSSQAFASVEEALHAFIQPEILDGPNQYFCERCKKKCDARKGLRFLHFPYLLTLQL
KRFDFDYTTMHRIKLNDRMTFPEELDMSTFIDVEDEKSPQTESCTDSGAENEGSCHSDQM
SNDFSNDDGVDEGICLETNSGTEKISKSGLEKNSLIYELFSVMVHSGSAAGGHYYACIKS
FSDEQWYSFNDQHVSRITQEDIKKTHGGSSGSRGYYSSAFASSTNAYMLIYRLKDPARNA
KFLEVDEYPEHIKNLVQKERELEEQEKRQREIERNTCKIKLFCLHPTKQVMMENKLEVHK
DKTLKEAVEMAYKMMDLEEVIPLDCCRLVKYDEFHDYLERSYEGEEDTPMGLLLGGVKST
YMFDLLLETRKPDQVFQSYKPGEVMVKVHVVDLKAESVAAPITVRAYLNQTVTEFKQLIS
KAIHLPAETMRIVLERCYNDLRLLSVSSKTLKAEGFFRSNKVFVESSETLDYQMAFADSH
LWKLLDRHANTIRLFVLLPEQSPGSYSKRTAYQKAGGDSGNVDDDCERVKGPVGSLKSVE
AILEESTEKLKSLSLQQQQDGDNGDSSKSTETSDFENIESPLNERDSSASVDNRELEQHI
QTSDPENFQSEERSDSDVNNDRSTSSVDSDILSSSHSSDTLCNADNAQIPLANGLDSHSI
TSSRRTKANEGKKETWDTAEEDSGTDSEYDESGKSRGEMQYMYFKAEPYAADEGSGEGHK
WLMVHVDKRITLAAFKQHLEPFVGVLSSHFKVFRVYASNQEFESVRLNETLSSFSDDNKI
TIRLGRALKKGEYRVKVYQLLVNEQEPCKFLLDAVFAKGMTVRQSKEELIPQLREQCGLE
LSIDRFRLRKKTWKNPGTVFLDYHIYEEDINISSNWEVFLEVLDGVEKMKSMSQLAVLSR
RWKPSEMKLDPFQEVVLESSSVDELREKLSEISGIPLDDIEFAKGRGTFPCDISVLDIHQ
DLDWNPKVSTLNVWPLYICDDGAVIFYRDKTEELMELTDEQRNELMKKESSRLQKTGHRV
TYSPRKEKALKIYLDGAPNKDLTQD
Download sequence
Identical sequences ENSGGOP00000009329 ENSGGOP00000026122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]