SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026125 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026125
Domain Number 1 Region: 207-241
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000053
Family Tudor domain 0.017
Further Details:      
 
Domain Number 2 Region: 163-188
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000628
Family CCCH zinc finger 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026125   Gene: ENSGGOG00000004801   Transcript: ENSGGOT00000025480
Sequence length 500
Comment pep:known_by_projection chromosome:gorGor3.1:20:61967292:61996401:1 gene:ENSGGOG00000004801 transcript:ENSGGOT00000025480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEESLESALQTYRAQLQQVELALGAGLDSSEQADLRQLQGDLKELIELTEASLVSVRKS
RLLAALDEERPGRQEDAEYQAFREAITEAVEAPAAARGSGSETVPKAEAGPESAAGGLSG
TKVSAPYYSSWGTLEYHNAMVVGTEEAEDGSAGVRVLYLYPTHKSLKPCPFFLEGKCRFK
ENCRFSHGQVVSLDELRPFQDPDLSSLQAGSSCLAKHQDGLWHAARITDVDNGYYTVKFD
SLLLREAVVEGDGILPPLRTEATESDSDSDGTGDSSYARVVGSDAVDSGTCSSAFAGWEV
HTRGIGSRLLTKMGYEFGKGLGRHAEGRVEPIHAVVLPRGKSLDQCVETLQKQTRVGKAG
TNKPPRCRGRGARPGGRPAPRNVFDFLNEKLQGQAPGALEAGAAPAGRRSKDMYRASKSA
KRALSLRLFQTEEKIERTQRDIRSIQEALARNAGRHSVASAQLQEKLAGAQRQLGQLRAQ
EAGLQQEQRKADTHKKMTEF
Download sequence
Identical sequences ENSGGOP00000026125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]