SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026161 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026161
Domain Number 1 Region: 108-407
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.7e-57
Family Ankyrin repeat 0.0002
Further Details:      
 
Domain Number 2 Region: 465-509
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000262
Family SOCS box-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026161   Gene: ENSGGOG00000000311   Transcript: ENSGGOT00000025310
Sequence length 516
Comment pep:known_by_projection chromosome:gorGor3.1:7:149642669:149654399:-1 gene:ENSGGOG00000000311 transcript:ENSGGOT00000025310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGQVSLGAWDTGAFCLSVFPSCCLSLCLWHIPLLLPTSPPPHSPLPAHMLMSWAPEECK
GQGEPLDDRHPLCARLVEKPSRGSEEHLKSGPGPIVTRTASGPALAFWQAVLAGDVGCVS
RILADSSTGLAPDSVFDTSDPERWRDFRFNIRALRLWSLTYKEELTTPLHVAASRGHTEV
LRLLLRRRARPDSAPGGRTALHEACAAGHTACVHVLLVAGADPNIADQDGKRPLHLCRGP
GTLECAELLLRFGARVDGRSEEEEETPLHVAARLGHVELADLLLRRGACPDARNTEGWTP
LLAACDVRCQSTADAEATTARCLQLCSLLLSAGADADAADQDKQRPLHLACRRGHAAVVE
LLLSCGVSANTMDYGGHTPLHCALQGPAAALAQSPEHVVRALLNHGAVRVWPGALPKVLE
RWSTCPRTIEVLMNTYSVVQLPEEAVGLVTPETLQKHQRFYSSLFALVRQPRSLQHLSRC
ALRSHLEGSLPHALPRLPLPPRLLRYLQLDFEGVLY
Download sequence
Identical sequences ENSGGOP00000026161 ENSGGOP00000026025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]