SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026172 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026172
Domain Number 1 Region: 193-305
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.03e-21
Family Voltage-gated potassium channels 0.0042
Further Details:      
 
Domain Number 2 Region: 19-46,89-158
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.63e-19
Family Voltage-gated potassium channels 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026172   Gene: ENSGGOG00000012778   Transcript: ENSGGOT00000033062
Sequence length 391
Comment pep:known_by_projection chromosome:gorGor3.1:2a:48336513:48385722:-1 gene:ENSGGOG00000012778 transcript:ENSGGOT00000033062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPPGGCRSGPSHLNEDTGRFVLLAALIGLYLVAGATVFSALESPGEAEARARWGATLRNF
SAAHGVAEPELRAFLRHYEAALAAGVRADALRPRWDFPGAFYFVGTVVSTIGFGMTTPAT
VGGKAFLIAYGLFGCAGTILFFNLFLERIISLLAFIMRACRERQLRRSGLLPATFRRGSA
LSEADSLAGWKPSVYHVLLILGLFAVLLSCCASAMYTSVEGWDYVDSLYFCFVTFSTIGF
GDLVSSQHAAYRNQGLYRLGNFLFILLGVCCIYSLFNVISILIKQVLNWMLRKLSCRCCA
RCCPAPGAPLARRNAIDSDAEGRRLSGELISMRDLTASNKVSLALLQKQLSETANGYPRS
VCVNTRQNGFSGGVGALGIMNNRLAETSASR
Download sequence
Identical sequences ENSGGOP00000026172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]