SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026241 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026241
Domain Number 1 Region: 275-338
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000103
Family LIM domain 0.039
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000026241
Domain Number - Region: 333-359
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00332
Family LIM domain 0.029
Further Details:      
 
Domain Number - Region: 243-278
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0963
Family LIM domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026241   Gene: ENSGGOG00000013915   Transcript: ENSGGOT00000029632
Sequence length 365
Comment pep:known_by_projection chromosome:gorGor3.1:3:8782040:8848351:1 gene:ENSGGOG00000013915 transcript:ENSGGOT00000029632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKVAKDLNPGVKKMSLGQLQSARGVACLGCKGTCSGFEPHSWRKICKSCKCSQEDHCLT
SDLEDDRKIGRLLMDSKYSTLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEW
APPGVTQKLGLQYMELIPKEKQPVTGTEGAFYRRRQLMHQLPIYDQDPSRCRGLLENELK
LMEEFVKQYKSEALGVGEVALPGQGGLPKEEGKQQEKPEGAETTAATTNGSLSDPSKEVE
YVCELCKGVAPPDSPVVYSDRAGYNKQWHPTCFVCAKCSEPLVDLIYFWKDGAPWCGRHY
CESLRPRCSGCDEIIFAEDYQRVEDLAWHRKHFVCEGCEQLLSGRAYIVTKGQLLCPTCS
KSKRS
Download sequence
Identical sequences G3SDR1 K6ZQS3 K7EV16
ENSGGOP00000026241 ENSPPYP00000024394 XP_002813534.1.23681 XP_004033580.1.27298 ENSPPYP00000024394 ENSGGOP00000013572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]