SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026253 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026253
Domain Number 1 Region: 124-305
Classification Level Classification E-value
Superfamily p53-like transcription factors 4.35e-64
Family Rel/Dorsal transcription factors, DNA-binding domain 0.00000334
Further Details:      
 
Domain Number 2 Region: 300-433
Classification Level Classification E-value
Superfamily E set domains 1.12e-47
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0000235
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026253   Gene: ENSGGOG00000003380   Transcript: ENSGGOT00000031852
Sequence length 579
Comment pep:known_by_projection chromosome:gorGor3.1:19:42212070:42249410:1 gene:ENSGGOG00000003380 transcript:ENSGGOT00000031852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRSGPASGPSVPTGRAMPSRRVARPPAAPELGALGKRGWGSGEASPPVFSSPAEIIDEY
IKENGFGLDGGQPGPGEGLPRLVSRGAASLSTVTLGPVAPPATPPPWGCPLGRLVPPAPG
PGPQPHLVITEQPKQRGMRFRYECEGRSAGSILGESSTEASKTLPAIELRDCGGLREVEV
TACLVWKDWPHRVHPHSLVGKDCTDGICRVRLRPHVSPRHSFNNLGIQCVRKKEIEAAIE
RKIQLGIDPYNAGSLKNHQEVDMNVVRICFQASYRDQQGQMRRMDPVLSEPVYDKKSTNT
SELRICRINKESGPCTGGEELYLLCDKVQKEDISVVFSRASWEGRADFSQADVHRQIAIV
FKTPPYEDLEIAEPVTVNVFLQRLTDGVCSEPLPFTYLPRDHDSYGVDKKRKRGMPDVLG
ELNSSDPHGIESKRRKKKPAILDHFLPNHSSGPFLPPSALLPDPDFFSGTVSLPGLEPPG
GPDLLDDGFAYDPTAPTLFTMLDLLPPAPPHASAVVCSGGAGAVVGETAGPEPLTLDSYQ
APGPGDGGTASLVGSNMFPNQYREAAFGGGLLSPGPEAT
Download sequence
Identical sequences ENSGGOP00000026253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]