SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026269 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026269
Domain Number 1 Region: 25-224
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.49e-45
Family DBL homology domain (DH-domain) 0.0000329
Further Details:      
 
Domain Number 2 Region: 210-353
Classification Level Classification E-value
Superfamily PH domain-like 9.38e-34
Family Pleckstrin-homology domain (PH domain) 0.00083
Further Details:      
 
Domain Number 3 Region: 469-598
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.24e-28
Family DEP domain 0.0011
Further Details:      
 
Domain Number 4 Region: 373-463
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.88e-27
Family DEP domain 0.0029
Further Details:      
 
Domain Number 5 Region: 669-735
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000434
Family PDZ domain 0.017
Further Details:      
 
Domain Number 6 Region: 573-664
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000802
Family PDZ domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026269   Gene: ENSGGOG00000025407   Transcript: ENSGGOT00000030900
Sequence length 1601
Comment pep:known_by_projection chromosome:gorGor3.1:8:66322282:66537918:1 gene:ENSGGOG00000025407 transcript:ENSGGOT00000030900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HGNGSIIPREEQQCTRVSVLQQNYYTQQMEFYTLAFLHRMNQCAASKVDKNVTEETVKML
FSNIEDILAVHKEFLKVVEECLHPEPNAQQEVGTCFLHFKDKFRIYDEYCSNHEKAQKLL
LELNKIRTIRTFLLNCMLLGGRKNTDVPLEGYLVTPIQRICKYPLILKKQELLKRTPRKH
SDYAAVMEALQAMKAVCSNINEAKRQMEKLEVLEEWQSHIEGWEGSNITDTCTEMLMCGV
LLKISSGNIQERVFFLFDNLLVYCKRKHSLRRLKNSKASTDGHRYLFRGRINTEVMEVEN
VDDGTADFHSSGHIVVNGWKIHNTAKNKWFVCMAKTPEEKHEWFEAILKERERRKGLKLG
MEQDTWVMISEQGEKLYKMMCRQGNLIKDRKRKLTTFPKCFLGSEFVSWLLEIGEIHRPE
EGVHLGQALLENGIIHHVTDKHQFKPEQMLYRFRYDDGTFYPPRNEMQDVISKGVRLYCR
LHSLFTPVIRDKDYHLRTYKSVVMANKLIDWLIAQGDCRTREEAMIFGVGLCDNGFMHHV
LEKSEFKDEPLLFRFFSDEEMEGSNMKHRLMKHDLKVVENVIAKSLLIKSNEGSYGFGLE
DKNKVPIIKLVEKGSNAEMAGMEVGKKIFAINGDLVFMRPFNEVDCFLKSCLNSRKPLRV
LVSTKPRETVKIPDSADGLGFQIRGFGPSVVHAVGRGTVAAAAGLHPGQCIIKVNGINVS
KETHASVIAHVTACRKYRRPMKQDSIQWVYNSIESAQEDLQKSHSKPPGDEAGDAFDCKV
EEVIDKFNTMAIIDGKKEHVSLTVDNVHLEYGVVYEYDSTAGIKCNVVEKMIEPKGFFSL
TAKILEALAKSDEHFVQNCTSLNSLNEVIPTDLQSKFSALCSERIEHICQRISSYKKFSR
VLKNRAWPTFKQAKSKISPLHSSDFCPTNCHVNVMEVSYPKTSTSLGSAFGVQLDSRKHN
SHDKENKSSEQGKLSPMVYIQHTITTMAAPSGLSLGQQDGHGLRYLLKEEDLETQDIYQK
LLGKLQTALKEVEMCVCQIDDLLSSITYSPKLERKTSEGIIPTESDNEKGERNSKRVCFN
VAGDEQEDSGHDTISNRDSYSDCNSNRNSIASFTSICSSQCSSYFHSDEMDSDLGDELPL
SVRISHDKQDKIHSCLEHLFSQVDSITNLLKGQAVVRAFDQTKYLTPGRGLQEFQQEMEP
KLSCPKRLRLHIKQDPWNLPSSVRTLAQNIRKFVEETKRRITMIINEYSDNSETQLRRDM
VFCQTLVATVCAFSEQLMAALNQMFDNSKENEMETWEASRRWLDQIANAGVLFHFQSLLS
PNLTDEQAMLEDTLVALFDLEKVSFYFKPSEEEPLVANVPLTYQVEGSRQALKVYFYIDS
YHFEQLPQRLKNGGGFKIHPVLFAQALESMEGYYYRDNVSVEEFQAQINAASLEKVKQYN
QKLRAFYLDKSNSPPNSTSKAAYVDKLMRPLNALDELYRLVASFIRSKRTAACANTACSA
SGVGLLSVSSELCNRLGACHIIMCSSGVHRCTLSVTLEQAIILARSHGLPPRYIMQATDV
MRKQGARVQNTAKNLGVRDRTPQSAPRLYKLCEPPPPAGEE
Download sequence
Identical sequences ENSGGOP00000026269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]