SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026277 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026277
Domain Number 1 Region: 14-202
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.37e-27
Family G proteins 0.0021
Further Details:      
 
Domain Number 2 Region: 419-583
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.74e-24
Family G proteins 0.0089
Further Details:      
 
Domain Number 3 Region: 168-268,310-369
Classification Level Classification E-value
Superfamily EF-hand 5.74e-22
Family Calmodulin-like 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026277   Gene: ENSGGOG00000006643   Transcript: ENSGGOT00000032489
Sequence length 584
Comment pep:known_by_projection chromosome:gorGor3.1:5:51971742:52012478:-1 gene:ENSGGOG00000006643 transcript:ENSGGOT00000032489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRRDLYFYRIYFARVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPERVPTHIVDYSE
AEQSDEQLHQEISQANVICIVYAVNNKHSIDKVTSRWIPLINERTDKDSRLPLILVGNKS
DLVEYSSMETILPIMNQYTEIETCVECSAKNLKNISELFYYAQKAVLHPTGPLYCPEEKE
MKPACIKALTRIFKISDQDNDGTLNDAELNFFQRICFNTPLAPQALEDVKNVVRKHISDG
VADSGLTLKGFLFLHTLFIQRGRHETTWTVLRRFGYDDDLDLTPEYLFPLLKIPPDCTTE
LNHHAYLFLQSTFDKHDLDRDCALSPDELKDLFKVFPYIPWGPDVNNTVCTNERGWITYQ
GFLSQWTTLWTFFCINNNFHSFIGYFPYENILFYDEIQLDCCTILTRDKKIDLQKKQTQR
NVFRCNVIGVKNCGKSGVLQALLGRNLMRQKKIREDHKSYYAINTVYVYGQEKYLLLHDI
SESEFLTEAEIICDVVCLVYDVSNPKSFEYCARIFKQHFMDSRIPCLIVAAKSDLHEVKQ
EYSISPTDFCRKHKMPPPQAFTCNTADAPSKDIFVKLTTMAMYP
Download sequence
Identical sequences ENSGGOP00000026277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]