SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026308 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026308
Domain Number 1 Region: 32-108
Classification Level Classification E-value
Superfamily Ribosomal proteins S24e, L23 and L15e 1.08e-30
Family L23p 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026308   Gene: ENSGGOG00000016736   Transcript: ENSGGOT00000024742
Sequence length 121
Comment pep:novel chromosome:gorGor3.1:5:55628123:55631314:-1 gene:ENSGGOG00000016736 transcript:ENSGGOT00000024742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKIEDNNTLVFIVD
VKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVATKLGSSKLSPA
A
Download sequence
Identical sequences ENSGGOP00000026308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]