SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026326 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026326
Domain Number 1 Region: 5-204
Classification Level Classification E-value
Superfamily Tubulin nucleotide-binding domain-like 1.57e-71
Family Tubulin, GTPase domain 0.0000000121
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000026326
Domain Number - Region: 205-255
Classification Level Classification E-value
Superfamily Tubulin C-terminal domain-like 0.00165
Family Tubulin, C-terminal domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026326   Gene: ENSGGOG00000024251   Transcript: ENSGGOT00000023667
Sequence length 261
Comment pep:known_by_projection chromosome:gorGor3.1:2b:108230787:108233224:1 gene:ENSGGOG00000024251 transcript:ENSGGOT00000023667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSDKTIRGGDDSFNIFFSETGAGKHVPQALFVDLEPAVLQPIRTRTYRQIFHPEQLITG
KEDAANNYAWGHYTIGKEFIDLLLDRIRKPADQCTGLQGFLVFHSLGGGTGSDVTSFLME
RLSVNYGKKSKLEFSMSTAVVKPYNSILTTHTTLEHSDCAFMVDNEAIYDICHRNLDIER
PTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYLTSTSPWPPMHQSSLQKRY
TTSSCWWQRLPMPALSLPTRW
Download sequence
Identical sequences ENSGGOP00000026326 ENSGGOP00000026326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]