SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026333 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026333
Domain Number 1 Region: 671-779
Classification Level Classification E-value
Superfamily SRCR-like 7.06e-36
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000964
Further Details:      
 
Domain Number 2 Region: 184-552
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 1.96e-33
Family Soluble quinoprotein glucose dehydrogenase 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026333   Gene: ENSGGOG00000008155   Transcript: ENSGGOT00000029177
Sequence length 782
Comment pep:known_by_projection chromosome:gorGor3.1:14:81459133:81604017:1 gene:ENSGGOG00000008155 transcript:ENSGGOT00000029177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARARAGALLALWVLGAAAHPQCLDFRPPFRPPQPLRLCAQYSDFGCCDEGRDAELTRRF
WALASRVDAAEWAACAGYARDLLCQECSPYAAHLYDAEDPFTPLRTVPGLCQDYCLDMWH
KCRGLFRHLSTDQELWALEGNRARFCRYLSLDDTDYCFPYLLVNKNLNSNLGHVVADAKG
CLQLCLEEVANGLRNPVAMVHARDGTHRFFVAEQVGLVWAYLPDRSRLGRPFLNISRVVL
TSPWEGDERGFLGIAFHPSFRHNRRLYVYYSVGIRSSEWIRISEFRVSEDDENAVDHSSE
RIILEVKEPASNHNGGQLLFGDDGYLYIFTGDGGMAGDPFGTFGNAQNKSALLGKVLRID
VDRKERGLPYGIPPDNPFVGDPAAQPEVYALGVRNMWRCSFDRGDPSSGAGRGRLFCGDV
GQNKFEEVDLVERGGNYGWRAREGFECYDRSLCANTSLNDLLPIFAYPHTTGKSVTGGYV
YRGCEYPNLNGLYIFGDFMSGRLMSLQENPGTGQWQYSEICMGHGQTCEFPGLINNYYPY
IISFGEDEAGELYFMSTGEPSATAPRGVVYKIIDASRRAPPGKCQIQPAQVKIRSRLIPF
VPKEKFIPKTRSTPRPTARASTRAPRRGRPTXXXXXXXXXXXXXXXXXXSRRGGGRRRGR
LNSASRAFRDGEVRLVRPAGLSSGSGRVEVFVGGRWGTVCDDSWNISGAAVVCRQLGFAY
AVRAVKRAEFGQGGSLPILLDDVRCTGWERNLLECQHNGVGTHNCEHDEDAGVVCSHQNP
DL
Download sequence
Identical sequences ENSGGOP00000026333 ENSGGOP00000026333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]