SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026356 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026356
Domain Number 1 Region: 120-285
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 2.75e-70
Family A middle domain of Talin 1 0.0000003
Further Details:      
 
Domain Number 2 Region: 1917-2107
Classification Level Classification E-value
Superfamily I/LWEQ domain 4.91e-51
Family I/LWEQ domain 0.00012
Further Details:      
 
Domain Number 3 Region: 1461-1595
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.35e-47
Family VBS domain 0.00000721
Further Details:      
 
Domain Number 4 Region: 847-983
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.18e-41
Family VBS domain 0.028
Further Details:      
 
Domain Number 5 Region: 444-509,540-602
Classification Level Classification E-value
Superfamily I/LWEQ domain 4.45e-29
Family I/LWEQ domain 0.0000781
Further Details:      
 
Domain Number 6 Region: 696-829
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 9.26e-29
Family VBS domain 0.013
Further Details:      
 
Domain Number 7 Region: 1091-1177
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000000000000124
Family I/LWEQ domain 0.0092
Further Details:      
 
Domain Number 8 Region: 1627-1754
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000000235
Family VBS domain 0.02
Further Details:      
 
Domain Number 9 Region: 1318-1436
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000706
Family VBS domain 0.045
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000026356
Domain Number - Region: 1206-1281
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000282
Family VBS domain 0.041
Further Details:      
 
Domain Number - Region: 2-31
Classification Level Classification E-value
Superfamily PH domain-like 0.0082
Family Third domain of FERM 0.002
Further Details:      
 
Domain Number - Region: 1729-1851
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.034
Family I/LWEQ domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026356   Gene: ENSGGOG00000015139   Transcript: ENSGGOT00000025327
Sequence length 2163
Comment pep:known_by_projection chromosome:gorGor3.1:15:41908014:42055003:1 gene:ENSGGOG00000015139 transcript:ENSGGOT00000025327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKK
STILQQQFNRTGKAEHGSVALPAVMRSGSSGPETFNVGSMPSPQQQVMVGQMHRGHMPPL
TSAQQALMGTINTSMHAVQQAQDDLSELDSLPPLGQDMASRVWVQNKVDESKHEIHSQVD
AITAGTASVVNLTAGDPADTDYTAVGCAITTISSNLTEMSKGVKLLAALMDDEVGSGEDL
LRAARTLAGAVSDLLKAVQPTSGEPRQTVLTAAGSIGQASGDLLRQIGENETDERFQHIF
ILVKAFFFPLFVIVLQHSSQMTFARGRFLARGRCWLLYSSYFQKEIKIDFSKITGTIRPK
NNARSKSVLGKKGGFCVSGFQTAGNIFILGSNLDAWLRTRAWRFSFFAPAYQRSRDKTVA
APEVLLTFEKQTNRPHPLFCLLGEMVRQARVLAQATSDLVNAMRSDAEAEIDMENSKKLL
AAAKLLADSTARMVEAAKGAAANPENEDQQQRLREAAEGLRVATNAAAQNAIKKKIVNRL
EVAAKQAAAAATQTIAASQNAAVSNKNPAAQQQLVQSCKAVADHIPQLVQGVRGSQAQAE
DLSAQLALIISSQNFLQPGSKMVSSAKAAVPTVSDQAAAMQLSQCAKNLATSLAELRTAS
QKAHEACGPMEIDSALNTVQTLKNELQDAKMAAVESQLKPLPGETLEKCAQDLGSTSKAV
GSSMAQLLTCAAQGNEHYTGVAARETAQALKTLAQAARGVAASTTDPAAAHAMLDSARDV
MEGSAMLIQEAKQALIAPGDAERQQRLAQVAKAVSHSLNNCVNCLPGQKDVDVALKSIGE
SSKKLLVDSLPPSTKPFQEAQSELNQAAADLNQSAGEVVHATRGQSGELAAASGKFSDDF
DEFLDAGIEMAGQAQTKEDQIQVIGNLKNISMASSKLLLAAKSLSVDPGAPNAKNLLAAA
ARAVTESINQLITLCTQQAPGQKECDNALRELETVKGMLDNPNEPVSDLSYFDCIESVME
NSKVLGESMAGISQNAKTGDLPAFGECVGIASKALCGLTEAAAQAAYLVGISDPNSQAGH
QGLVDPIQFARANQAIQMACQNLVDPGSSPSQVLSAATIVAKHTSALCNACRIASSKTAN
PVAKRHFVQSAKEVANSTANLVKTIKALDGDFSEDNRNKCRIATAPLIEAVENLTAFASN
PEFVSIPAQISSEGSQAQEPILVSAKTMLESSSYLIRTARSLAINPKDPPTWSVLAGHSH
TVSDSIKSLITSIRDKAPGQRECDYSIDGINRCIRDIEQASLAAVSQSLATRDDISVEAL
QEQLTSVVQEIGHLIDPIATAARGEAAQLGHKVTQLASYFEPLILAAVGVASKILDHQQQ
MTVLDQTKTLAESALQMLYAAKEGGGNPKEAQHTHDAITEAAQLMKEAVDDIMVTLNEAA
SEVGLVGGMVDAIAEAMSKLDEGTPPEPKGTFVDYQTTVVKYSKAIAVTAQEMMTKSVTN
PEELGGLASQMTSDYGHLAFQGQMAAATAEPEEIGFQIRTRVQDLGHGCIFLVQKAGALQ
ICPTDSYTKRELIECARAVTEKVSLVLSALQAGNKGTQACITAATAVSGIIADLDTTIMF
ATAGTLNAENSETFADHRENILKTAKALVEDTKLLVSGAASTPDKLAQAAQSSAATITQL
AEVVKLGAASLGSDDPETQVVLINAIKDVAKALSDLISATKGAASKPADDPSMYQLKGAA
KVMVTNVTSLLKTVKAVEDEATRGTRALEATIECIKQELTVFQSKDVPEKTSSPEESIRM
TKGITMATAKAVAAGNSCRQEDVIATANLSRKAVSDMLTACKQASFHPDVSDEMRTRALR
FGTECTLGYLDLLEHVLVILQKPTPELKQQLAAFSKRVAGAVTELIQAAEAMKGTEWVDP
EDPTVIAETELLGAAASIEAAAKKLEQLKPRAKPKQADETLDFEEQILEAAKSIAAATSA
LVKSASAAQRELVAQGKVGSIPANAADDGQWSQGLISAARMVAAATSSLCEAANASVQGH
ASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMRRLQAAGNAVKRASDNLVRAAQKAA
FGKADDDDVVVKTKFVGGIAQIIAAQEEMLKKERELEEARKKLAQIRQQQYKFLPTELRE
DEG
Download sequence
Identical sequences ENSGGOP00000026356 ENSGGOP00000014801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]